ACVR1C/ALK7 antibody (N-Term)
-
- Target See all ACVR1C/ALK7 (ACVR1C) Antibodies
- ACVR1C/ALK7 (ACVR1C) (Activin Receptor Type 1C (ACVR1C))
-
Binding Specificity
- N-Term
-
Reactivity
- Human
-
Host
- Rabbit
-
Clonality
- Polyclonal
-
Conjugate
- This ACVR1C/ALK7 antibody is un-conjugated
-
Application
- Western Blotting (WB)
- Specificity
- ACVR1 C antibody was raised against the N terminal of ACVR1
- Purification
- Affinity purified
- Immunogen
- ACVR1 C antibody was raised using the N terminal of ACVR1 corresponding to a region with amino acids QVFCHSSNNVTKTECCFTDFCNNITLHLPTASPNAPKLGPMELAIIITVP
- Top Product
- Discover our top product ACVR1C Primary Antibody
-
anti-Activin Receptor Type 1C (ACVR1C) (AA 22-113) antibody
ACVR1C Reactivity: Human WB, ELISA, IHC Host: Rabbit Polyclonal unconjugated
anti-Activin Receptor Type 1C (ACVR1C) (AA 21-120) antibodyACVR1C Reactivity: Human, Mouse, Rat WB, ELISA, FACS, IHC (p), IF (cc), IF (p), IHC (fro) Host: Rabbit Polyclonal unconjugated
anti-Activin Receptor Type 1C (ACVR1C) (AA 33-62), (N-Term) antibodyACVR1C Reactivity: Human WB, IHC (p) Host: Rabbit Polyclonal RB8195 unconjugated
anti-Activin Receptor Type 1C (ACVR1C) (Internal Region) antibodyACVR1C Reactivity: Human, Cow, Pig, Bat IHC, IHC (p) Host: Rabbit Polyclonal unconjugated
anti-Activin Receptor Type 1C (ACVR1C) (N-Term) antibodyACVR1C Reactivity: Human, Mouse, Rat WB, IHC, IHC (p) Host: Rabbit Polyclonal unconjugated
anti-Activin Receptor Type 1C (ACVR1C) antibodyACVR1C Reactivity: Human, Mouse, Rat IHC Host: Rabbit Polyclonal unconjugated
anti-Activin Receptor Type 1C (ACVR1C) antibodyACVR1C Reactivity: Human ELISA, IHC, IF Host: Rabbit Polyclonal unconjugated
anti-Activin Receptor Type 1C (ACVR1C) (C-Term) antibodyACVR1C Reactivity: Human, Mouse, Rat WB, ELISA, IHC Host: Rabbit Polyclonal unconjugated
anti-Activin Receptor Type 1C (ACVR1C) (Center) antibodyACVR1C Reactivity: Human WB, IHC (p) Host: Rabbit Polyclonal unconjugated
anti-Activin Receptor Type 1C (ACVR1C) (AA 21-493) antibodyACVR1C Reactivity: Human WB, IHC, ICC Host: Rabbit Polyclonal unconjugated
-
- Application Notes
-
WB: 1 µg/mL
Optimal conditions should be determined by the investigator. - Comment
-
ACVR1C Blocking Peptide, catalog no. 33R-7772, is also available for use as a blocking control in assays to test for specificity of this ACVR1C antibody
- Restrictions
- For Research Use only
-
- Format
- Lyophilized
- Reconstitution
- Lyophilized powder. Add distilled water for a 1 mg/mL concentration of ACVR0 antibody in PBS
- Concentration
- Lot specific
- Buffer
- PBS
- Handling Advice
-
Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use. - Storage
- 4 °C/-20 °C
- Storage Comment
- Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.
-
- Target
- ACVR1C/ALK7 (ACVR1C) (Activin Receptor Type 1C (ACVR1C))
- Alternative Name
- ACVR1C (ACVR1C Products)
- Synonyms
- ACVRLK7 antibody, ALK7 antibody, Alk-7 antibody, C230097P10 antibody, Alk7 antibody, habrec1 antibody, activin A receptor type 1C antibody, activin A receptor, type IC antibody, ACVR1C antibody, Acvr1c antibody
- Background
- ACVR1C is a type I receptor for the TGFB family of signaling molecules. Upon ligand binding, type I receptors phosphorylate cytoplasmic SMAD transcription factors, which then translocate to the nucleus and interact directly with DNA or in complex with other transcription factors.
- Molecular Weight
- 55 kDa (MW of target protein)
- Pathways
- Negative Regulation of Hormone Secretion, Positive Regulation of Endopeptidase Activity
-
