CLEC9A antibody

Catalog No. ABIN6719546

Product Details anti-CLEC9A Antibody

Target: CLEC9A (C-Type Lectin Domain Family 9, Member A (CLEC9A))

Reactivity: Human

Host: Rabbit

Clonality: Polyclonal

Conjugate: This CLEC9A antibody is un-conjugated

Application: Flow Cytometry (FACS), Immunocytochemistry (ICC), Immunohistochemistry (Frozen Sections) (IHC (fro))

Purpose: Rabbit IgG polyclonal antibody for CLEC9A detection. Tested with IHC-F, ICC, FCM in Human.

Sequence: EIWSIWHTSQ ENCLKEGSTL LQIESKEEMD FITGSLRKIK

Cross-Reactivity (Details): No cross reactivity with other proteins.

Characteristics: Rabbit IgG polyclonal antibody for CLEC9A detection. Tested with IHC-F, ICC, FCM in Human.

Purification: Immunogen affinity purified.

Immunogen: A synthetic peptide corresponding to a sequence of human CLEC9A (EIWSIWHTSQENCLKEGSTLLQIESKEEMDFITGSLRKIK).

Isotype: IgG

Application Details

Application Notes:

Application details: Immunohistochemistry(Frozen Section)|0.5-1 μg/mL Immunocytochemistry|0.5-1 μg/mL Flow Cytometry|1-3 μg/1x106 cells

Comment:

Tested Species: In-house tested species with positive results. Other applications have not been tested. Optimal dilutions should be determined by end users.

Restrictions: For Research Use only

Handling

Format: Lyophilized

Reconstitution: Add 0.2 mL of distilled water will yield a concentration of 500 μg/mL.

Buffer: Each vial contains 4 mg Trehalose, 0.9 mg NaCl, 0.2 mg Na2HPO4, 0.05 mg Sodium azide.

Preservative: Sodium azide

Precaution of Use: This product contains Sodium azide: a POISONOUS AND HAZARDOUS SUBSTANCE which should be handled by trained staff only.

Storage: 4 °C,-20 °C

Storage Comment: At -20°C for one year. After reconstitution, at 4°C for one month.
It can also be aliquotted and stored frozen at -20 °C for a longer time. Avoid repeated freezing and thawing.

Target Details for CLEC9A

Target: CLEC9A (C-Type Lectin Domain Family 9, Member A (CLEC9A))

Alternative Name: CLEC9A (CLEC9A Products)

Synonyms: 9830005G06Rik antibody, DNGR-1 antibody, DNGR1 antibody, UNQ9341 antibody, RGD1562513 antibody, C-type lectin domain family 9, member a antibody, C-type lectin domain containing 9A antibody, C-type lectin domain family 9, member A antibody, Clec9a antibody, CLEC9A antibody

Background:

Synonyms: C-type lectin domain family 9 member A, CLEC9A, UNQ9341/PRO34046

Background: C-type lectin domain family 9 member A is a protein that in humans is encoded by the CLEC9A gene. CLEC9A is a group V C-type lectin-like receptor (CTLR) that functions as an activation receptor and is expressed on myeloid lineage cells. By genomic sequence analysis, this gene is mapped to chromosome 12p13.31, centromeric to CLEC12B (617573) and telomeric to CLEC1A (606782).

Gene ID: 283420