CLEC9A antibody
-
- Target See all CLEC9A Antibodies
- CLEC9A (C-Type Lectin Domain Family 9, Member A (CLEC9A))
-
Reactivity
- Human
-
Host
- Rabbit
-
Clonality
- Polyclonal
-
Conjugate
- This CLEC9A antibody is un-conjugated
-
Application
- Flow Cytometry (FACS), Immunocytochemistry (ICC), Immunohistochemistry (Frozen Sections) (IHC (fro))
- Purpose
- Rabbit IgG polyclonal antibody for CLEC9A detection. Tested with IHC-F, ICC, FCM in Human.
- Sequence
- EIWSIWHTSQ ENCLKEGSTL LQIESKEEMD FITGSLRKIK
- Cross-Reactivity (Details)
- No cross reactivity with other proteins.
- Characteristics
- Rabbit IgG polyclonal antibody for CLEC9A detection. Tested with IHC-F, ICC, FCM in Human.
- Purification
- Immunogen affinity purified.
- Immunogen
- A synthetic peptide corresponding to a sequence of human CLEC9A (EIWSIWHTSQENCLKEGSTLLQIESKEEMDFITGSLRKIK).
- Isotype
- IgG
- Top Product
- Discover our top product CLEC9A Primary Antibody
-
-
- Application Notes
-
Application details: Immunohistochemistry(Frozen Section)|0.5-1 μg/mL Immunocytochemistry|0.5-1 μg/mL Flow Cytometry|1-3 μg/1x106 cells
- Comment
-
Tested Species: In-house tested species with positive results. Other applications have not been tested. Optimal dilutions should be determined by end users.
- Restrictions
- For Research Use only
-
- Format
- Lyophilized
- Reconstitution
- Add 0.2 mL of distilled water will yield a concentration of 500 μg/mL.
- Buffer
- Each vial contains 4 mg Trehalose, 0.9 mg NaCl, 0.2 mg Na2HPO4, 0.05 mg Sodium azide.
- Preservative
- Sodium azide
- Precaution of Use
- This product contains Sodium azide: a POISONOUS AND HAZARDOUS SUBSTANCE which should be handled by trained staff only.
- Storage
- 4 °C,-20 °C
- Storage Comment
-
At -20°C for one year. After reconstitution, at 4°C for one month.
It can also be aliquotted and stored frozen at -20 °C for a longer time. Avoid repeated freezing and thawing.
-
- Target
- CLEC9A (C-Type Lectin Domain Family 9, Member A (CLEC9A))
- Alternative Name
- CLEC9A (CLEC9A Products)
- Synonyms
- 9830005G06Rik antibody, DNGR-1 antibody, DNGR1 antibody, UNQ9341 antibody, RGD1562513 antibody, C-type lectin domain family 9, member a antibody, C-type lectin domain containing 9A antibody, C-type lectin domain family 9, member A antibody, Clec9a antibody, CLEC9A antibody
- Background
-
Synonyms: C-type lectin domain family 9 member A, CLEC9A, UNQ9341/PRO34046
Background: C-type lectin domain family 9 member A is a protein that in humans is encoded by the CLEC9A gene. CLEC9A is a group V C-type lectin-like receptor (CTLR) that functions as an activation receptor and is expressed on myeloid lineage cells. By genomic sequence analysis, this gene is mapped to chromosome 12p13.31, centromeric to CLEC12B (617573) and telomeric to CLEC1A (606782).
- Gene ID
- 283420
-