GAD65 antibody

Catalog No. ABIN7880883

The Mouse Monoclonal anti-GAD65 antibody is suitable to detect GAD65 in samples from Human, Rat and Mouse. It has been validated for WB, FACS, IHC (p) and IF.

Quick Overview for GAD65 antibody (ABIN7880883)

Target: GAD65 (GAD2) (Glutamate Decarboxylase 2 (Pancreatic Islets and Brain, 65kDa) (GAD2))

Reactivity: Human, Rat, Mouse

Host: Mouse

Clonality: Monoclonal

Conjugate: This GAD65 antibody is un-conjugated

Application: Western Blotting (WB), Flow Cytometry (FACS), Immunohistochemistry (Paraffin-embedded Sections) (IHC (p)), Immunofluorescence (IF)

Clone: 7G2

Product Details anti-GAD65 Antibody

Purpose: GAD2 Antibody / GAD65

Sequence: KVIDFHYPNE LLQEYNWELA DQPQNLEEIL MHCQ

Purification: Affinity purified

Immunogen: Amino acids KVIDFHYPNELLQEYNWELADQPQNLEEILMHCQ from the human protein were used as the immunogen for the GAD2 antibody.

Isotype: IgG2a

Application Details

Application Notes: Optimal dilution of the GAD2 antibody should be determined by the researcher.

Restrictions: For Research Use only

Handling

Format: Lyophilized

Buffer: 0.5 mg/mL if reconstituted with 0.2 mL sterile DI water

Storage: 4 °C,-20 °C

Storage Comment: After reconstitution, the GAD2 antibody can be stored for up to one month at 4oC. For long-term, aliquot and store at -20oC. Avoid repeated freezing and thawing.

Target Details for GAD65

Target: GAD65 (GAD2) (Glutamate Decarboxylase 2 (Pancreatic Islets and Brain, 65kDa) (GAD2))

Alternative Name: GAD2

Background: Glutamate decarboxylase 2, also known as GAD65, is an enzyme that in humans is encoded by the GAD2 gene. This gene encodes one of several forms of glutamic acid decarboxylase, identified as a major autoantigen in insulin-dependent diabetes. The enzyme encoded is responsible for catalyzing the production of gamma-aminobutyric acid from L-glutamic acid. A pathogenic role for this enzyme has been identified in the human pancreas since it has been identified as an autoantibody and an autoreactive T cell target in insulin-dependent diabetes. This gene may also play a role in the stiff man syndrome. Alternative splicing results in multiple transcript variants that encode the same protein.

UniProt: Q05329