XRCC6 antibody

Catalog No. ABIN7882709

The Mouse Monoclonal anti-XRCC6 antibody (Clone 3D7) (ABIN7882709) specifically detects XRCC6 in WB, IF, FACS and IHC (p). The antibody is reactive with Human samples.

Quick Overview for XRCC6 antibody (ABIN7882709)

Target: XRCC6 (X-Ray Repair Complementing Defective Repair in Chinese Hamster Cells 6 (XRCC6))

Reactivity: Human

Host: Mouse

Clonality: Monoclonal

Conjugate: This XRCC6 antibody is un-conjugated

Application: Western Blotting (WB), Immunofluorescence (IF), Flow Cytometry (FACS), Immunohistochemistry (Paraffin-embedded Sections) (IHC (p))

Clone: 3D7

Product Details anti-XRCC6 Antibody

Purpose: Ku70/XRCC6 Antibody

Sequence: AIVEKLRFTY RSDSFENPVL QQHFRNLEAL ALD

Purification: Antigen affinity purified

Immunogen: Amino acids AIVEKLRFTYRSDSFENPVLQQHFRNLEALALD were used as the immunogen for the Ku70/XRCC6 antibody.

Isotype: IgG1

Application Details

Application Notes: Optimal dilution of the Ku70/XRCC6 antibody should be determined by the researcher.

Restrictions: For Research Use only

Handling

Format: Lyophilized

Buffer: 0.5 mg/mL if reconstituted with 0.2 mL sterile DI water

Storage: 4 °C,-20 °C

Storage Comment: After reconstitution, the Ku70/XRCC6 antibody can be stored for up to one month at 4oC. For long-term, aliquot and store at -20oC. Avoid repeated freezing and thawing.

Target Details for XRCC6

Target: XRCC6 (X-Ray Repair Complementing Defective Repair in Chinese Hamster Cells 6 (XRCC6))

Alternative Name: Ku70/XRCC6

Background: XRCC6 (X-Ray Repair, Complementing Defective, In Chinese Hamster, 6), also called Ku70, G22P1 or TLAA, is a protein that in humans, is encoded by the XRCC6 gene. In addition, the XRCC6 gene encodes subunit p70 of the p70/p80 autoantigen which consists of 2 proteins of molecular mass of approximately 70,000 and 80,000 daltons that dimerize to form a 10 S DNA-binding complex. The XRCC6 gene is mapped to 22q13.2. XRCC6 and Mre11 are differentially expressed during meiosis. XRCC6 interacts with Baxa, a mediator of mitochondrial-dependent apoptosis. Disruption of both FANCC and XRCC6 suppressed sensitivity to crosslinking agents, diminished chromosome breaks, and reversed defective homologous recombination. Ku70 binds directly to free DNA ends, committing them to NHEJ repair. In early meiotic prophase, however, when meiotic recombination is most probably initiated, Mre11 was abundant, whereas XRCC6 was not detectable.

UniProt: P12956

Pathways: DNA Damage Repair