anti-Dog (Canine) YWHAZ antibody for Western Blotting

Recommended YWHAZ Antibody

tyrosine 3-Monooxygenase/tryptophan 5-Monooxygenase Activation Protein, zeta Polypeptide (YWHAZ) Antibodies
  • 14-3-3-zeta
  • KCIP-1
  • 14-3-3zeta
  • Ywhaz
  • ACYPI003154
  • 14-3-3z
  • kcip-1
  • ywhaq
  • 1433z
  • ywhaz
  • ywhazb
  • 1110013I11Rik
  • AI596267
  • AL022924
  • AU020854
  • ywhaza
  • fb14h09
  • wu:fb05g08
  • wu:fb14h09
  • ywhai
  • zgc:55807
  • 14-3-3
  • 14-3-3 zeta
  • 14-3-3ZETA
  • 14-3-3leo
  • 2G1
  • 4-3-3 zeta
  • 5.11
  • 549
  • BEST:GH05075
  • CG17870
  • D14-3-3
  • D14-3-3zeta
  • Dmel\\CG17870
  • K
  • LEO
  • Leo
  • PAR-5
  • PAR5
  • Par-5
  • d14-3-3zeta
  • l(2)07103
  • l(2)46CFe
  • l(2)46Ee
  • leo
  • par-5
  • tyrosine 3-monooxygenase/tryptophan 5-monooxygenase activation protein zeta
  • 14-3-3 protein zeta
  • tyrosine 3-monooxygenase/tryptophan 5-monooxygenase activation protein zeta L homeolog
  • tyrosine 3-monooxygenase/tryptophan 5-monooxygenase activation protein, zeta polypeptide
  • tyrosine 3-monooxygenase/tryptophan 5-monooxygenase activation protein, zeta
  • tyrosine 3-monooxygenase/tryptophan 5-monooxygenase activation protein zeta S homeolog
  • 14-3-3 protein zeta/delta pseudogene
  • CG17870 gene product from transcript CG17870-RE
  • 14-3-3zeta
  • ywhaz
  • 1433z
  • ywhaz.L
  • Ywhaz
  • ywhaz.S
  • LOC100855903
Human, Mouse (Murine), Rat (Rattus), Dog (Canine)
This YWHAZ antibody is un-conjugated
Western Blotting (WB)

Available images

Catalog No. ABIN629824
$ 369.29
Plus shipping costs $45.00
Relevance Score ABIN Application Conjugate Host Isotype Epitope Clonality References Details
10 ABIN1491173 IHC IHC (p) WB Rabbit AA 200-245 Polyclonal 0
7.8903255 ABIN2783207 IHC WB Rabbit Middle Region Polyclonal 1
7 ABIN6747116 IHC IHC (p) WB Rabbit C-Term Polyclonal 0
7 ABIN960408 IHC IHC (p) WB Rabbit AA 50-100 Polyclonal 0
4.8903255 ABIN2783206 WB Rabbit C-Term Polyclonal 1
4.8903255 ABIN2463127 ELISA WB Rabbit Polyclonal 0
4 ABIN321366 WB Rabbit IgG C-Term Polyclonal 0
1 ABIN609110 ELISA IHC IHC (p) WB Rabbit IgG AA 1-10 Polyclonal 0
1 ABIN1731317 IHC (p) WB Rabbit IgG AA 200-245 Polyclonal 0
1 ABIN600345 IHC WB Rabbit IgG Polyclonal 0
-6.163019 ABIN4276714 IHC (p) WB Rabbit Polyclonal 0
-6.163019 ABIN4276716 IHC (p) WB Rabbit Polyclonal 0
-13.053345 ABIN4276715 IHC (p) WB Rabbit Polyclonal 0
-13.053345 ABIN4276713 IHC (p) WB Rabbit Polyclonal 0


Antigen tyrosine 3-Monooxygenase/tryptophan 5-Monooxygenase Activation Protein, zeta Polypeptide (YWHAZ) Antibodies
Epitope C-Term
(59), (12), (11), (10), (10), (10), (7), (7), (6), (6), (4), (4), (4), (3), (3), (3), (2), (2), (2), (2), (2), (2), (2), (1), (1), (1), (1), (1), (1), (1), (1), (1), (1), (1), (1), (1), (1)
Reactivity Human, Mouse (Murine), Rat (Rattus), Dog (Canine)
(248), (176), (145), (25), (24), (20), (19), (10), (7), (7), (6), (6), (4), (3), (2), (2), (1), (1)
Host Rabbit
(240), (10)
Conjugate This YWHAZ antibody is un-conjugated
(10), (5), (5), (4), (4), (4), (4), (4), (4), (3), (3), (3), (1), (1), (1), (1), (1)
Application Western Blotting (WB)
(207), (125), (88), (60), (53), (24), (14), (13), (12), (6), (3), (3)

Product Details anti-YWHAZ Antibody

Target Details YWHAZ Application Details Handling Images
Specificity YWHAZ antibody was raised against the C terminal of YWHAZ
Purification Purified
Immunogen YWHAZ antibody was raised using the C terminal of YWHAZ corresponding to a region with amino acids AFDEAIAELDTLSEESYKDSTLIMQLLRDNLTLWTSDTQGDEAEAGEGGE
Plasmids, Primers & others

Target Details YWHAZ

Product Details anti-YWHAZ Antibody Application Details Handling Images back to top
Alternative Name YWHAZ (YWHAZ Antibody Abstract)
Background YWHAZ belongs to the 14-3-3 family of proteins which mediate signal transduction by binding to phosphoserine-containing proteins. This highly conserved protein family is found in both plants and mammals, and this protein is 99% identical to the mouse, rat and sheep orthologs. The protein interacts with IRS1 protein, suggesting a role in regulating insulin sensitivity.
Molecular Weight 28 kDa (MW of target protein)
Pathways Apoptosis, Hormone Transport, Myometrial Relaxation and Contraction, Regulation of Leukocyte Mediated Immunity, Positive Regulation of Immune Effector Process, Synaptic Membrane, Production of Molecular Mediator of Immune Response, Maintenance of Protein Location

Application Details

Product Details anti-YWHAZ Antibody Target Details YWHAZ Handling Images back to top
Application Notes WB: 5 µg/mL
Optimal conditions should be determined by the investigator.

YWHAZ Blocking Peptide, catalog no. 33R-1158, is also available for use as a blocking control in assays to test for specificity of this YWHAZ antibody

Restrictions For Research Use only


Product Details anti-YWHAZ Antibody Target Details YWHAZ Application Details Images back to top
Format Lyophilized
Reconstitution Lyophilized powder. Add distilled water for a 1 mg/mL concentration of YWHAZ antibody in PBS
Concentration Lot specific
Buffer PBS
Handling Advice Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.
Storage 4 °C
Storage Comment Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.


Product Details anti-YWHAZ Antibody Target Details YWHAZ Application Details Handling back to top
Supplier Images
Western Blotting (WB) image for anti-tyrosine 3-Monooxygenase/tryptophan 5-Monooxygenase Activation Protein, zeta Polypeptide (YWHAZ) (C-Term) antibody (ABIN629824) YWHAZ antibody used at 5 ug/ml to detect target protein.