anti-Human PLG antibody for Immunohistochemistry

Recommended PLG Antibody (supplied by: Log in to see )

Antigen
Plasminogen (PLG) Antibodies
  • wu:fb70e09
  • PLG
  • LPA
  • plg
  • Ab1-346
  • AI649309
  • Pg
  • plasminogen
  • plg
  • PLG
  • Plg
Reactivity
Human
420
101
57
7
6
4
4
4
3
2
1
1
Host
Rabbit
218
165
50
42
25
2
Clonality
Polyclonal
Conjugate
This PLG antibody is un-conjugated
36
26
24
10
10
7
7
6
6
6
6
6
6
6
6
6
6
5
4
1
1
1
1
1
1
1
1
1
Application
Immunohistochemistry (IHC), Immunohistochemistry (Paraffin-embedded Sections) (IHC (p))
311
227
138
124
36
28
27
20
19
17
17
15
14
13
8
5
4
4
4
3
3
2
2
1
1
1
1
Supplier
Log in to see
Supplier Product No.
Log in to see
Request

Get this product for free

Submit your validation data for this product and get a full refund. I want to validate this product

Learn more

Available images

Catalog No. ABIN4346086
Contact our Customer Service for availability and price in your country.
Relevance Score ABIN Application Conjugate Host Isotype Epitope Supplier Clonality References Details
8.714457 ABIN1078446 ICC IHC IP WB Rabbit IgG AA 274-560 Log in to see Polyclonal
8.714457 ABIN4346088 IHC WB Rabbit IgG Log in to see Polyclonal
8.714457 ABIN2433617 IHC ELISA WB Rabbit IgG Log in to see Polyclonal
1 ABIN4346087 ICC IF IHC IHC (p) WB Rabbit IgG Center Log in to see Polyclonal
1 ABIN236063 IHC ELISA Mouse IgG1 Log in to see 5H3
1 ABIN1860259 ICC IHC IP WB Rabbit IgG AA 79-466 Log in to see Polyclonal
1 ABIN5596692 ELISA IHC WB HRP Goat IgG Log in to see Polyclonal
1 ABIN265679 IHC (p) IP IHC ELISA Mouse IgG2a Log in to see 9E7
1 ABIN265681 IHC (p) IHC ELISA Mouse IgG1 Log in to see 8E7
1 ABIN2882233 IF IHC WB Rabbit IgG Log in to see Polyclonal
1 ABIN4238494 ELISA IHC IHC (p) DyLight 488 Mouse IgG2a Log in to see 9E7
1 ABIN4238495 ELISA IHC IHC (p) DyLight 550 Mouse IgG2a Log in to see 9E7
1 ABIN4238497 ELISA IHC IHC (p) DyLight 680 Mouse IgG2a Log in to see 9E7
1 ABIN4238498 ELISA IHC IHC (p) DyLight 755 Mouse IgG2a Log in to see 9E7
1 ABIN4238500 ELISA IHC IHC (p) Alexa Fluor 488 Mouse IgG2a Log in to see 9E7
1 ABIN4238502 ELISA IHC IHC (p) Alexa Fluor 700 Mouse IgG2a Log in to see 9E7
1 ABIN4238508 ELISA IHC IHC (p) FITC Mouse IgG2a Log in to see 9E7
1 ABIN4238499 ELISA IHC IHC (p) Alexa Fluor 405 Mouse IgG2a Log in to see 9E7
1 ABIN4238501 ELISA IHC IHC (p) Alexa Fluor 647 Mouse IgG2a Log in to see 9E7
1 ABIN4238507 ELISA IHC IHC (p) Biotin Mouse IgG2a Log in to see 9E7

General

Antigen Plasminogen (PLG) Antibodies
Reactivity Human
(420), (101), (57), (7), (6), (4), (4), (4), (3), (2), (1), (1)
Host Rabbit
(218), (165), (50), (42), (25), (2)
Clonality
Polyclonal
Conjugate This PLG antibody is un-conjugated
(36), (26), (24), (10), (10), (7), (7), (6), (6), (6), (6), (6), (6), (6), (6), (6), (6), (5), (4), (1), (1), (1), (1), (1), (1), (1), (1), (1)
Application Immunohistochemistry (IHC), Immunohistochemistry (Paraffin-embedded Sections) (IHC (p))
(311), (227), (138), (124), (36), (28), (27), (20), (19), (17), (17), (15), (14), (13), (8), (5), (4), (4), (4), (3), (3), (2), (2), (1), (1), (1), (1)
Pubmed 1 reference available
Supplier Log in to see

Product Details anti-PLG Antibody

Target Details PLG Application Details Handling References for anti-PLG antibody (ABIN4346086) Images
Specificity Specificity of antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins.
Purification Immunogen affinity purified
Immunogen This antibody was developed against Recombinant Protein corresponding to amino acids:NKRWELCDIPRCTTPPPSSGPTYQCLKGTGENYRGNVAVTVSGHTCQHWSAQTPHTHNRTPE
Isotype IgG

Target Details PLG

Product Details anti-PLG Antibody Application Details Handling References for anti-PLG antibody (ABIN4346086) Images back to top
Antigen
Alternative Name Plasminogen (PLG Antibody Abstract)
Background Gene Symbol: PLG
Gene ID 5340
Research Area Angiogenesis, Proteolysis / Ubiquitin, Proteases, Coagulation
Pathways Complement System

Application Details

Product Details anti-PLG Antibody Target Details PLG Handling References for anti-PLG antibody (ABIN4346086) Images back to top
Application Notes Immunohistochemistry, Immunohistochemistry-Paraffin 1:20 - 1:50For IHC-Paraffin HIER pH 6 retrieval is recommended.
Comment

The antibodies are intended for use in vitro experiments only. Our antibodies have not been tested nor are recommended for use in vivo.

Restrictions For Research Use only

Handling

Product Details anti-PLG Antibody Target Details PLG Application Details References for anti-PLG antibody (ABIN4346086) Images back to top
Format Liquid
Buffer PBS ( pH 7.2) and 40 % Glycerol
Buffer contains: 0.02 % Sodium Azide
Preservative Sodium azide
Precaution of Use This product contains Sodium azide: a POISONOUS AND HAZARDOUS SUBSTANCE which should be handled by trained staff only.
Storage 4 °C,-20 °C
Storage Comment Store at 4°C short term. Aliquot and store at -20°C long term. Avoid freeze-thaw cycles.

References for anti-PLG antibody (ABIN4346086)

Product Details anti-PLG Antibody Target Details PLG Application Details Handling Images back to top
Product cited in:

Gründel, Friedrich, Pfeiffer, Jacobs, Dumke: "Subunits of the Pyruvate Dehydrogenase Cluster of Mycoplasma pneumoniae Are Surface-Displayed Proteins that Bind and Activate Human Plasminogen." in: PLoS ONE, Vol. 10, Issue 5, pp. e0126600, 2015 (Sample species: Human). Further details: ELISA

Images

Product Details anti-PLG Antibody Target Details PLG Application Details Handling References for anti-PLG antibody (ABIN4346086) back to top
Supplier Images
Immunohistochemistry (IHC) image for anti-Plasminogen (PLG) antibody (ABIN4346086) Immunohistochemistry: Plasminogen Antibody [NBP1-86015] - Staining of human colon sho...