anti-Human Ubiquitin Interaction Motif Containing 1 antibody for Immunohistochemistry (Paraffin-embedded Sections)

Recommended Ubiquitin Interaction Motif Containing 1 Antibody

Antigen
Ubiquitin Interaction Motif Containing 1 (UIMC1) Antibodies
  • UIMC1
  • RAP80
  • X2HRIP110
  • 9430016E08Rik
  • D330018D10Rik
  • D630032M02Rik
  • RIP110
  • Rxrip110
  • RGD1307009
  • ubiquitin interaction motif containing 1
  • UIMC1
  • Uimc1
Reactivity
Human
85
27
9
2
2
1
Host
Rabbit
67
16
3
Clonality
Polyclonal
Conjugate
Un-conjugated
3
2
2
1
1
1
1
1
1
1
1
1
Application
Immunocytochemistry (ICC), Immunofluorescence (IF), Immunohistochemistry (IHC), Immunohistochemistry (Paraffin-embedded Sections) (IHC (p)), Western Blotting (WB)
60
42
26
16
15
4
3
3
3
2
1
Options

Available images

Catalog No. ABIN4349369
Contact our Customer Service for availability and price in your country.
Relevance Score ABIN Application Conjugate Host Isotype Epitope Clonality References Details
11.585852 ABIN343912 ELISA IHC IHC (p) WB Rabbit IgG C-Term Polyclonal 0
11.585852 ABIN343913 ELISA IHC IHC (p) WB Rabbit IgG N-Term Polyclonal 0
11.5 ABIN541637 IHC (p) WB Rabbit Polyclonal 3
11.5 ABIN541636 IHC (p) WB Rabbit Polyclonal 3
9.474012 ABIN4349370 ICC IF IHC IHC (p) WB Rabbit IgG Polyclonal 0
7 ABIN1104923 ELISA IHC IHC (p) Goat AA 535-548 Polyclonal 0
7 ABIN372910 EIA IHC (p) WB Rabbit IgG C-Term Polyclonal 0
7 ABIN372911 EIA IF IHC (p) WB Rabbit IgG N-Term Polyclonal 0
4 ABIN1740578 IHC (p) ELISA Goat Internal Region Polyclonal 0
4 ABIN1740579 IHC (p) ELISA WB Rabbit IgG Polyclonal 0
4 ABIN1740580 IHC (p) IHC ELISA WB Rabbit IgG Polyclonal 0
1.9740124 ABIN250739 ICC IF IHC IHC (p) IP WB Rabbit C-Term Polyclonal 3
1 ABIN5555155 EIA IHC (p) WB Rabbit IgG C-Term Polyclonal 0
1 ABIN5555156 EIA IHC (p) WB Rabbit IgG N-Term Polyclonal 0
1 ABIN1946823 IF IHC IHC (p) IP WB Rabbit IgG AA 650-719, C-Term Polyclonal 0
1 ABIN1946824 IF IHC IHC (p) Rabbit IgG AA 650-719, C-Term Polyclonal 0
1 ABIN2771779 IHC (p) IHC ELISA Goat Internal Region Polyclonal 0
0.47401237 ABIN4349367 ELISA ICC IF IHC IHC (p) WB Rabbit C-Term Polyclonal 0
0.47401237 ABIN4349368 ELISA ICC IF IHC IHC (p) WB Rabbit N-Term Polyclonal 0

General

Antigen Ubiquitin Interaction Motif Containing 1 (UIMC1) Antibodies
Reactivity Human
(85), (27), (9), (2), (2), (1)
Host Rabbit
(67), (16), (3)
Clonality
Polyclonal
Conjugate Un-conjugated
(3), (2), (2), (1), (1), (1), (1), (1), (1), (1), (1), (1)
Application Immunocytochemistry (ICC), Immunofluorescence (IF), Immunohistochemistry (IHC), Immunohistochemistry (Paraffin-embedded Sections) (IHC (p)), Western Blotting (WB)
(60), (42), (26), (16), (15), (4), (3), (3), (3), (2), (1)
Pubmed 8 references available
Supplier

Product details

Target Details Application Details Handling References Images
Specificity Specificity of antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins.
Purification Immunogen affinity purified
Immunogen This antibody was developed against Recombinant Protein corresponding to amino acids:LLRKAIAESLNSCRPSDASATRSRPLATGPSSQSHQEKTTDSGLTEGIWQLVPPSLFKGSHISQGNEAEEREEPWDHTEKTEEEPVSGSSG
Isotype IgG

Target Details

Product details Application Details Handling References Images back to top
Antigen
Alternative Name RAP80 (UIMC1 Antibody Abstract)
Background Gene Symbol: UIMC1
Gene ID 51720
UniProt Q96RL1
Pathways DNA Damage Repair, Nuclear Hormone Receptor Binding, Positive Regulation of Response to DNA Damage Stimulus

Application Details

Product details Target Details Handling References Images back to top
Application Notes Western Blot 1:100 - 1:250, Immunohistochemistry 1:10-1:500, Immunocytochemistry/Immunofluorescence 1 - 4 μg/mL, Immunohistochemistry-Paraffin 1:50-1:200For IHC-Paraffin, HIER pH 6 retrieval is recommended. IF fixation/permeabilization: PFA/Triton X-100.
Comment

The antibodies are intended for use in vitro experiments only. Our antibodies have not been tested nor are recommended for use in vivo.

Restrictions For Research Use only

Handling

Product details Target Details Application Details References Images back to top
Format Liquid
Buffer PBS ( pH 7.2) and 40 % Glycerol
Buffer contains: 0.02 % Sodium Azide
Preservative Sodium azide
Precaution of Use This product contains Sodium azide: a POISONOUS AND HAZARDOUS SUBSTANCE which should be handled by trained staff only.
Storage 4 °C,-20 °C
Storage Comment Store at 4°C short term. Aliquot and store at -20°C long term. Avoid freeze-thaw cycles.

References

Product details Target Details Application Details Handling Images back to top
Product cited in:

Baranes-Bachar, Levy-Barda, Oehler, Reid, Soria-Bretones, Voss, Chung, Park, Liu, Yoon, Li, Dellaire, Misteli, Huertas, Rothenberg, Ramadan, Ziv, Shiloh: "The Ubiquitin E3/E4 Ligase UBE4A Adjusts Protein Ubiquitylation and Accumulation at Sites of DNA Damage, Facilitating Double-Strand Break Repair." in: Molecular cell, Vol. 69, Issue 5, pp. 866-878.e7, 2019 (Sample species: Human).

Bodo, Campagne, Thin, Higginson, Vargas, Hua, Fuller, Ackerstaff, Russell, Zhang, Klingler, Cho, Kaag, Mazaheri, Rimner, Manova-Todorova, Epel, Zatcky, Cleary, Rao, Yamada, Zelefsky, Halpern et al.: "Single-dose radiotherapy disables tumor cell homologous recombination via ischemia/reperfusion injury. ..." in: The Journal of clinical investigation, Vol. 129, Issue 2, pp. 786-801, 2019 Method employed by authors: Immunohistochemistry (Paraffin-embedded Sections) (IHC (p)) (Sample species: Human).

Watanabe, Iimori, Chan, Hara, Kitao, Maehara: "MDC1 methylation mediated by lysine methyltransferases EHMT1 and EHMT2 regulates active ATM accumulation flanking DNA damage sites." in: Scientific reports, Vol. 8, Issue 1, pp. 10888, 2018 Method employed by authors: Immunofluorescence (fixed cells) (IF/ICC) (Sample species: Human).

Yasuhara, Kato, Hagiwara, Shiotani, Yamauchi, Nakada, Shibata, Miyagawa: "Human Rad52 Promotes XPG-Mediated R-loop Processing to Initiate Transcription-Associated Homologous Recombination Repair." in: Cell, Vol. 175, Issue 2, pp. 558-570.e11, 2018 (Sample species: Human).

Ha, Ma, Lin, Tang, Lian, Zhao, Li, Zhen, Pei, Han, Malumbres, Jin, Chen, Zhao, Zhu, Zhang: "The anaphase promoting complex impacts repair choice by protecting ubiquitin signalling at DNA damage sites." in: Nature communications, Vol. 8, pp. 15751, 2017 (Sample species: Human).

Renaud, Barascu, Rosselli: "Impaired TIP60-mediated H4K16 acetylation accounts for the aberrant chromatin accumulation of 53BP1 and RAP80 in Fanconi anemia pathway-deficient cells." in: Nucleic acids research, Vol. 44, Issue 2, pp. 648-56, 2016 Method employed by authors: Immunohistochemistry (IHC)

Lin, Ratner, Whicker, Lee, Sartorelli: "Triapine disrupts CtIP-mediated homologous recombination repair and sensitizes ovarian cancer cells to PARP and topoisomerase inhibitors." in: Molecular cancer research : MCR, Vol. 12, Issue 3, pp. 381-93, 2014

Kato, Nakajima, Ui, Muto-Terao, Ogiwara, Nakada: "Fine-tuning of DNA damage-dependent ubiquitination by OTUB2 supports the DNA repair pathway choice." in: Molecular cell, Vol. 53, Issue 4, pp. 617-30, 2014 (Sample species: Human). Further details: Immunocytochemistry,Immunofluorescence

Images

Product details Target Details Application Details Handling References back to top
Supplier Images
Immunohistochemistry (Paraffin-embedded Sections) (IHC (p)) image for anti-Ubiquitin Interaction Motif Containing 1 (UIMC1) antibody (ABIN4349369) Immunohistochemistry-Paraffin: RAP80 Antibody [NBP1-87156] - Staining of human testis...
Western Blotting (WB) image for anti-Ubiquitin Interaction Motif Containing 1 (UIMC1) antibody (ABIN4349369) Western Blot: RAP80 Antibody [NBP1-87156] - Lane 1: Marker [kDa] 250, 130, 95, 72, 55...
Immunofluorescence (IF) image for anti-Ubiquitin Interaction Motif Containing 1 (UIMC1) antibody (ABIN4349369) Immunocytochemistry/Immunofluorescence: RAP80 Antibody [NBP1-87156] - Staining of hum...
Immunofluorescence (IF) image for anti-Ubiquitin Interaction Motif Containing 1 (UIMC1) antibody (ABIN4349369) Immunocytochemistry/Immunofluorescence: RAP80 Antibody - Staining of human cell line...
Immunohistochemistry (Paraffin-embedded Sections) (IHC (p)) image for anti-Ubiquitin Interaction Motif Containing 1 (UIMC1) antibody (ABIN4349369) Immunohistochemistry-Paraffin: RAP80 Antibody - Staining of human cerebral cortex us...
Immunohistochemistry (Paraffin-embedded Sections) (IHC (p)) image for anti-Ubiquitin Interaction Motif Containing 1 (UIMC1) antibody (ABIN4349369) Immunohistochemistry-Paraffin: RAP80 Antibody - Staining of human cerebral cortex, c...
Immunohistochemistry (Paraffin-embedded Sections) (IHC (p)) image for anti-Ubiquitin Interaction Motif Containing 1 (UIMC1) antibody (ABIN4349369) Immunohistochemistry-Paraffin: RAP80 Antibody - Staining of human colon using Anti-U...
Immunohistochemistry (Paraffin-embedded Sections) (IHC (p)) image for anti-Ubiquitin Interaction Motif Containing 1 (UIMC1) antibody (ABIN4349369) Immunohistochemistry-Paraffin: RAP80 Antibody - Staining of human lymph node using A...
Immunohistochemistry (Paraffin-embedded Sections) (IHC (p)) image for anti-Ubiquitin Interaction Motif Containing 1 (UIMC1) antibody (ABIN4349369) Immunohistochemistry-Paraffin: RAP80 Antibody - Staining of human testis using Anti-...
Western Blotting (WB) image for anti-Ubiquitin Interaction Motif Containing 1 (UIMC1) antibody (ABIN4349369) Western Blot: RAP80 Antibody - Analysis in control (vector only transfected HEK293T ...