anti-Human ADCY5 antibody for Immunohistochemistry

Recommended ADCY5 Antibody (supplied by: Log in to see )

Antigen
Adenylate Cyclase 5 (ADCY5) Antibodies
  • AC5
  • ADCY5
  • si:dkeyp-60a7.2
  • FDFM
  • AW121902
  • Ac5
  • RUT
  • adenylate cyclase 5
  • ADCY5
  • adcy5
  • Adcy5
Reactivity
Human
35
24
23
1
Host
Rabbit
31
6
Clonality
Polyclonal
Conjugate
This ADCY5 antibody is un-conjugated
2
1
1
1
1
1
1
1
1
1
1
1
1
1
Application
Immunohistochemistry (IHC), Immunohistochemistry (Paraffin-embedded Sections) (IHC (p))
18
13
13
9
5
5
4
2
2
2
Supplier
Log in to see
Supplier Product No.
Log in to see
Request

Get this product for free

Submit your validation data for this product and get a full refund. I want to validate this product

Learn more

Available images

Catalog No. ABIN4278418
Contact our Customer Service for availability and price in your country.
Relevance Score ABIN Application Conjugate Host Isotype Epitope Supplier Clonality References Details
8.883907 ABIN2432437 IHC ELISA Rabbit IgG Log in to see Polyclonal 0
8.883907 ABIN2427061 IHC ELISA Rabbit IgG Log in to see Polyclonal 0
1 ABIN1857910 ICC IHC WB Rabbit IgG AA 167-385 Log in to see Polyclonal 0
1 ABIN2906675 IF/ICC IHC IP WB Rabbit AA 167-385 Log in to see Polyclonal 0
1 ABIN6044146 ELISA IHC Rabbit IgG Log in to see Polyclonal 0
1 ABIN6043019 ELISA IHC Rabbit IgG Log in to see Polyclonal 0
1 ABIN6020366 IF/ICC IHC IP WB Mouse Log in to see 0

General

Antigen Adenylate Cyclase 5 (ADCY5) Antibodies
Reactivity Human
(35), (24), (23), (1)
Host Rabbit
(31), (6)
Clonality
Polyclonal
Conjugate This ADCY5 antibody is un-conjugated
(2), (1), (1), (1), (1), (1), (1), (1), (1), (1), (1), (1), (1), (1)
Application Immunohistochemistry (IHC), Immunohistochemistry (Paraffin-embedded Sections) (IHC (p))
(18), (13), (13), (9), (5), (5), (4), (2), (2), (2)
Supplier Log in to see

Product Details anti-ADCY5 Antibody

Target Details ADCY5 Application Details Handling Images
Specificity Specificity of antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins.
Purification Immunogen affinity purified
Immunogen This antibody was developed against Recombinant Protein corresponding to amino acids:YLKEHSIETFLTLRCTQKRKEEKAMIAKMNRQRTNSIGHNPPHWGAERPFYNHLGGNQVSKEMKRMGFEDPKDKNAQESANPEDEVDEFLGRAIDARSIDRLRS
Isotype IgG
Plasmids, Primers & others

Target Details ADCY5

Product Details anti-ADCY5 Antibody Application Details Handling Images back to top
Antigen
Alternative Name Adenylate Cyclase 5 (ADCY5 Antibody Abstract)
Background Gene Symbol: ADCY5
Gene ID 111
UniProt O95622
Pathways EGFR Signaling Pathway, Neurotrophin Signaling Pathway, Thyroid Hormone Synthesis, cAMP Metabolic Process, Myometrial Relaxation and Contraction, G-protein mediated Events, Interaction of EGFR with phospholipase C-gamma

Application Details

Product Details anti-ADCY5 Antibody Target Details ADCY5 Handling Images back to top
Application Notes Immunohistochemistry, Immunohistochemistry-Paraffin 1:20 - 1:50For IHC-Paraffin, HIER pH 6 retrieval is recommended.
Comment

The antibodies are intended for use in vitro experiments only. Our antibodies have not been tested nor are recommended for use in vivo.

Restrictions For Research Use only

Handling

Product Details anti-ADCY5 Antibody Target Details ADCY5 Application Details Images back to top
Format Liquid
Buffer PBS ( pH 7.2) and 40 % Glycerol
Buffer contains: 0.02 % Sodium Azide
Preservative Sodium azide
Precaution of Use This product contains Sodium azide: a POISONOUS AND HAZARDOUS SUBSTANCE which should be handled by trained staff only.
Storage 4 °C,-20 °C
Storage Comment Store at 4°C short term. Aliquot and store at -20°C long term. Avoid freeze-thaw cycles.

Images

Product Details anti-ADCY5 Antibody Target Details ADCY5 Application Details Handling back to top
Supplier Images
Immunohistochemistry (IHC) image for anti-Adenylate Cyclase 5 (ADCY5) antibody (ABIN4278418) Immunohistochemistry: Adenylate Cyclase 5 Antibody [NBP1-90279] - Staining of human u...
Immunofluorescence (Paraffin-embedded Sections) (IF (p)) image for anti-Adenylate Cyclase 5 (ADCY5) antibody (ABIN4278418) Immunohistochemistry-Paraffin: Adenylate Cyclase 5 Antibody - Staining of human urin...
Immunofluorescence (IF) image for anti-Adenylate Cyclase 5 (ADCY5) antibody (ABIN4278418) Immunocytochemistry/Immunofluorescence: Adenylate Cyclase 5 Antibody - Staining of h...