anti-Human ADCY5 antibody for Immunohistochemistry
Recommended ADCY5 Antibody (supplied by: Log in to see )
- Antigen
-
Adenylate Cyclase 5 (ADCY5) Antibodies
show synonyms for this antigen- AC5
- ADCY5
- si:dkeyp-60a7.2
- FDFM
- AW121902
- Ac5
- RUT
- adenylate cyclase 5
- ADCY5
- adcy5
- Adcy5
- Reactivity
-
Human
Alternatives - Host
-
Rabbit
Alternatives - Clonality
- Conjugate
-
This ADCY5 antibody is un-conjugated
Alternatives - Application
-
Immunohistochemistry (IHC), Immunohistochemistry (Paraffin-embedded Sections) (IHC (p))
Alternatives - Supplier
- Log in to see
- Supplier Product No.
- Log in to see
Get this product for free
Submit your validation data for this product and get a full refund. I want to validate this productAvailable images
Catalog No. ABIN4278418
Contact our Customer Service for availability and price in your country.
| Relevance Score | ABIN | Application | Conjugate | Host | Isotype | Epitope | Supplier | Clonality | References | Details |
|---|---|---|---|---|---|---|---|---|---|---|
| 8.883907 | ABIN2432437 | IHC ELISA | Rabbit | IgG | Log in to see | Polyclonal | 0 | |||
| 8.883907 | ABIN2427061 | IHC ELISA | Rabbit | IgG | Log in to see | Polyclonal | 0 | |||
| 1 | ABIN1857910 | ICC IHC WB | Rabbit | IgG | AA 167-385 | Log in to see | Polyclonal | 0 | ||
| 1 | ABIN2906675 | IF/ICC IHC IP WB | Rabbit | AA 167-385 | Log in to see | Polyclonal | 0 | |||
| 1 | ABIN6044146 | ELISA IHC | Rabbit | IgG | Log in to see | Polyclonal | 0 | |||
| 1 | ABIN6043019 | ELISA IHC | Rabbit | IgG | Log in to see | Polyclonal | 0 | |||
| 1 | ABIN6020366 | IF/ICC IHC IP WB | Mouse | Log in to see | 0 |
General |
|
|---|---|
| Antigen | Adenylate Cyclase 5 (ADCY5) Antibodies |
| Reactivity | Human Alternatives |
| Host | Rabbit Alternatives |
| Clonality | |
| Conjugate | This ADCY5 antibody is un-conjugated Alternatives |
| Application |
Immunohistochemistry (IHC), Immunohistochemistry (Paraffin-embedded Sections) (IHC (p))
Alternatives
|
| Supplier | Log in to see |
Product Details anti-ADCY5 AntibodyTarget Details ADCY5 Application Details Handling Images |
|
| Specificity | Specificity of antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins. |
| Purification | Immunogen affinity purified |
| Immunogen | This antibody was developed against Recombinant Protein corresponding to amino acids:YLKEHSIETFLTLRCTQKRKEEKAMIAKMNRQRTNSIGHNPPHWGAERPFYNHLGGNQVSKEMKRMGFEDPKDKNAQESANPEDEVDEFLGRAIDARSIDRLRS |
| Isotype | IgG |
| Plasmids, Primers & others | |
Target Details ADCY5Product Details anti-ADCY5 Antibody Application Details Handling Images back to top |
|
| Antigen | |
| Alternative Name | Adenylate Cyclase 5 (ADCY5 Antibody Abstract) |
| Background | Gene Symbol: ADCY5 |
| Gene ID | 111 |
| UniProt | O95622 |
| Pathways | EGFR Signaling Pathway, Neurotrophin Signaling Pathway, Thyroid Hormone Synthesis, cAMP Metabolic Process, Myometrial Relaxation and Contraction, G-protein mediated Events, Interaction of EGFR with phospholipase C-gamma |
Application DetailsProduct Details anti-ADCY5 Antibody Target Details ADCY5 Handling Images back to top |
|
| Application Notes | Immunohistochemistry, Immunohistochemistry-Paraffin 1:20 - 1:50For IHC-Paraffin, HIER pH 6 retrieval is recommended. |
| Comment |
The antibodies are intended for use in vitro experiments only. Our antibodies have not been tested nor are recommended for use in vivo. |
| Restrictions | For Research Use only |
HandlingProduct Details anti-ADCY5 Antibody Target Details ADCY5 Application Details Images back to top |
|
| Format | Liquid |
| Buffer |
PBS ( pH 7.2) and 40 % Glycerol Buffer contains: 0.02 % Sodium Azide |
| Preservative | Sodium azide |
| Precaution of Use | This product contains Sodium azide: a POISONOUS AND HAZARDOUS SUBSTANCE which should be handled by trained staff only. |
| Storage | 4 °C,-20 °C |
| Storage Comment | Store at 4°C short term. Aliquot and store at -20°C long term. Avoid freeze-thaw cycles. |
ImagesProduct Details anti-ADCY5 Antibody Target Details ADCY5 Application Details Handling back to top |
|
| Supplier Images |
Immunohistochemistry: Adenylate Cyclase 5 Antibody [NBP1-90279] - Staining of human u...
Immunohistochemistry-Paraffin: Adenylate Cyclase 5 Antibody - Staining of human urin...
Immunocytochemistry/Immunofluorescence: Adenylate Cyclase 5 Antibody - Staining of h...
|
