anti-Human SRA1 antibody for Immunofluorescence

Recommended SRA1 Antibody (supplied by: Log in to see )

Antigen
Steroid Receptor RNA Activator 1 (SRA1) Antibodies
  • SRA
  • SRAP
  • STRAA1
  • pp7684
  • AA959952
  • Sra
  • Srap
  • Straa1
  • Strra1
  • zgc:86613
  • P140SRA-1
  • SHYC
  • SRA1
  • steroid receptor RNA activator 1
  • steroid receptor RNA activator 1 S homeolog
  • cytoplasmic FMR1 interacting protein 1
  • SRA1
  • Sra1
  • sra1
  • sra1.S
  • CYFIP1
Reactivity
Human
64
6
6
4
4
4
3
2
2
Host
Rabbit
38
25
Clonality
Polyclonal
Conjugate
This SRA1 antibody is un-conjugated
2
2
2
2
2
2
Application
Immunocytochemistry (ICC), Immunofluorescence (IF), Immunohistochemistry (IHC), Immunohistochemistry (Paraffin-embedded Sections) (IHC (p))
65
46
24
9
2
1
Supplier
Log in to see
Supplier Product No.
Log in to see
Request

Get this product for free

Submit your validation data for this product and get a full refund. I want to validate this product

Learn more

Available images

Catalog No. ABIN4355861
Contact our Customer Service for availability and price in your country.
Relevance Score ABIN Application Conjugate Host Isotype Epitope Supplier Clonality References Details
1 ABIN1938067 IF IHC IHC (p) IP WB Rabbit IgG AA 180-237, C-Term Log in to see Polyclonal 0

General

Antigen Steroid Receptor RNA Activator 1 (SRA1) Antibodies
Reactivity Human
(64), (6), (6), (4), (4), (4), (3), (2), (2)
Host Rabbit
(38), (25)
Clonality
Polyclonal
Conjugate This SRA1 antibody is un-conjugated
(2), (2), (2), (2), (2), (2)
Application Immunocytochemistry (ICC), Immunofluorescence (IF), Immunohistochemistry (IHC), Immunohistochemistry (Paraffin-embedded Sections) (IHC (p))
(65), (46), (24), (9), (2), (1)
Supplier Log in to see

Product Details anti-SRA1 Antibody

Target Details SRA1 Application Details Handling Images
Purification Immunogen affinity purified
Immunogen This antibody was developed against a recombinant protein corresponding to amino acids: RMALLVQELSSHRWDAADDIHRSLMVDHVTEVSQWMVGVKRLIAEKRSLFSEEAANEEKSAATAEKNHTIPGFQQAS
Isotype IgG
Plasmids, Primers & others

Target Details SRA1

Product Details anti-SRA1 Antibody Application Details Handling Images back to top
Antigen
Alternative Name SRA1 (SRA1 Antibody Abstract)
Background Gene Symbol: SRA1
Gene ID 10011
Pathways EGFR Signaling Pathway, Stem Cell Maintenance, Regulation of Muscle Cell Differentiation, Tube Formation, Skeletal Muscle Fiber Development

Application Details

Product Details anti-SRA1 Antibody Target Details SRA1 Handling Images back to top
Application Notes Immunohistochemistry, Immunocytochemistry/Immunofluorescence 1 - 4 μg/mL, Immunohistochemistry-Paraffin 1:200 - 1:500For IHC-Paraffin HIER pH 6 retrieval is recommended.
Comment

The antibodies are intended for use in vitro experiments only. Our antibodies have not been tested nor are recommended for use in vivo.

Restrictions For Research Use only

Handling

Product Details anti-SRA1 Antibody Target Details SRA1 Application Details Images back to top
Format Liquid
Buffer PBS ( pH 7.2) and 40 % Glycerol
Buffer contains: 0.02 % Sodium Azide
Preservative Sodium azide
Precaution of Use This product contains Sodium azide: a POISONOUS AND HAZARDOUS SUBSTANCE which should be handled by trained staff only.
Storage 4 °C,-20 °C
Storage Comment Store at 4°C short term. Aliquot and store at -20°C long term. Avoid freeze-thaw cycles.

Images

Product Details anti-SRA1 Antibody Target Details SRA1 Application Details Handling back to top
Supplier Images
Immunohistochemistry (IHC) image for anti-Steroid Receptor RNA Activator 1 (SRA1) antibody (ABIN4355861) Immunohistochemistry: SRA1 Antibody [NBP2-47260] - Analysis of human Analysis of live...
Immunofluorescence (IF) image for anti-Steroid Receptor RNA Activator 1 (SRA1) antibody (ABIN4355861) Immunocytochemistry/Immunofluorescence: SRA1 Antibody [NBP2-47260] - Analysis of huma...
Immunofluorescence (Paraffin-embedded Sections) (IF (p)) image for anti-Steroid Receptor RNA Activator 1 (SRA1) antibody (ABIN4355861) Immunohistochemistry-Paraffin: SRA1 Antibody - Staining of human testis shows strong...