anti-Human Endothelin 2 antibody for Immunohistochemistry

Recommended Endothelin 2 Antibody (supplied by: Log in to see )

Endothelin 2 (EDN2) Antibodies
  • endothelin-2
  • EDN2
  • si:ch211-202b2.2
  • ET2
  • PPET2
  • VIC
  • Et2
  • ET-2
  • endothelin 2
  • EDN2
  • edn2
  • Edn2
This Endothelin 2 antibody is un-conjugated
Immunohistochemistry (IHC), Immunohistochemistry (Paraffin-embedded Sections) (IHC (p)), Western Blotting (WB)
Log in to see
Supplier Product No.
Log in to see

Get this product for free

Submit your validation data for this product and get a full refund. I want to validate this product

Learn more

Available images

Catalog No. ABIN4308204
Contact our Customer Service for availability and price in your country.
Relevance Score ABIN Application Conjugate Host Isotype Epitope Supplier Clonality References Details
8.907254 ABIN2423393 IHC ELISA WB Rabbit IgG Log in to see Polyclonal 0
8.907254 ABIN2421557 IHC ELISA Rabbit IgG Log in to see Polyclonal 0
8.907254 ABIN2430033 IHC ELISA Rabbit IgG Log in to see Polyclonal 0
1 ABIN5013495 ICC IHC WB Rabbit IgG AA 32-178 Log in to see Polyclonal 0
1 ABIN1822399 IF IHC Rabbit IgG Log in to see Polyclonal 0
1 ABIN2259783 IF IHC Rabbit IgG Log in to see Polyclonal 0
1 ABIN1085671 IHC ELISA Rabbit IgG Log in to see Polyclonal 0
1 ABIN5565459 FACS ICC IF IHC APC Rabbit AA 25-178 Log in to see Polyclonal 0
1 ABIN5565461 FACS ICC IF IHC FITC Rabbit AA 25-178 Log in to see Polyclonal 0
1 ABIN5565463 FACS ICC IF IHC PE Rabbit AA 25-178 Log in to see Polyclonal 0
1 ABIN2139609 IHC ELISA Rabbit IgG Log in to see Polyclonal 0
1 ABIN2872169 IHC Rabbit Log in to see Polyclonal 0
1 ABIN2927726 ELISA IF/ICC IHC WB Rabbit AA 32-178 Log in to see Polyclonal 0


Antigen Endothelin 2 (EDN2) Antibodies
Reactivity Human
(70), (24), (23), (4), (3), (2), (2), (1)
Host Rabbit
(64), (6)
Conjugate This Endothelin 2 antibody is un-conjugated
(5), (4), (3), (3), (3), (2), (1), (1), (1), (1), (1), (1), (1), (1), (1), (1), (1), (1)
Application Immunohistochemistry (IHC), Immunohistochemistry (Paraffin-embedded Sections) (IHC (p)), Western Blotting (WB)
(35), (25), (13), (13), (5), (4), (4), (4), (4), (3), (1)
Pubmed 1 reference available
Supplier Log in to see

Product Details anti-Endothelin 2 Antibody

Target Details Endothelin 2 Application Details Handling References for anti-Endothelin 2 antibody (ABIN4308204) Images
Specificity Specificity of antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins.
Purification Immunogen affinity purified
Immunogen This antibody was developed against Recombinant Protein corresponding to amino acids:LPRRCQCSSARDPACATFCLRRPWTEAGAVPSRKSPADVFQTGKTGATTGELLQRLRDISTVKSLFAKRQQEAMREPRSTHSRWR
Isotype IgG

Target Details Endothelin 2

Product Details anti-Endothelin 2 Antibody Application Details Handling References for anti-Endothelin 2 antibody (ABIN4308204) Images back to top
Alternative Name Endothelin 2 (EDN2 Antibody Abstract)
Background Gene Symbol: EDN2
Gene ID 1907
Pathways Hormone Activity, Negative Regulation of Hormone Secretion, Regulation of Systemic Arterial Blood Pressure by Hormones

Application Details

Product Details anti-Endothelin 2 Antibody Target Details Endothelin 2 Handling References for anti-Endothelin 2 antibody (ABIN4308204) Images back to top
Application Notes Western Blot 1:100 - 1:250, Immunohistochemistry, Immunohistochemistry-Paraffin 1:50 - 1:200For HIER pH 6 retrieval is recommended.

The antibodies are intended for use in vitro experiments only. Our antibodies have not been tested nor are recommended for use in vivo.

Restrictions For Research Use only


Product Details anti-Endothelin 2 Antibody Target Details Endothelin 2 Application Details References for anti-Endothelin 2 antibody (ABIN4308204) Images back to top
Format Liquid
Buffer PBS ( pH 7.2) and 40 % Glycerol
Buffer contains: 0.02 % Sodium Azide
Preservative Sodium azide
Precaution of Use This product contains Sodium azide: a POISONOUS AND HAZARDOUS SUBSTANCE which should be handled by trained staff only.
Storage 4 °C,-20 °C
Storage Comment Store at 4°C short term. Aliquot and store at -20°C long term. Avoid freeze-thaw cycles.

References for anti-Endothelin 2 antibody (ABIN4308204)

Product Details anti-Endothelin 2 Antibody Target Details Endothelin 2 Application Details Handling Images back to top
Product cited in:

Schütte, Bisht, Heukamp, Kebschull, Florin, Haarmann, Hoffmann, Bendas, Buettner, Brossart, Feldmann: "Hippo signaling mediates proliferation, invasiveness, and metastatic potential of clear cell renal cell carcinoma." in: Translational oncology, Vol. 7, Issue 2, pp. 309-21, 2014 Further details: Immunohistochemistry


Product Details anti-Endothelin 2 Antibody Target Details Endothelin 2 Application Details Handling References for anti-Endothelin 2 antibody (ABIN4308204) back to top
Supplier Images
Immunohistochemistry (IHC) image for anti-Endothelin 2 (EDN2) antibody (ABIN4308204) Immunohistochemistry: Endothelin 2 Antibody [NBP1-87942] - Staining of human bone mar...
Western Blotting (WB) image for anti-Endothelin 2 (EDN2) antibody (ABIN4308204) Western Blot: Endothelin 2 Antibody [NBP1-87942] - Lane 1: Marker [kDa] 250, 130, 95,...
Immunofluorescence (Paraffin-embedded Sections) (IF (p)) image for anti-Endothelin 2 (EDN2) antibody (ABIN4308204) Immunohistochemistry-Paraffin: Endothelin 2 Antibody - Staining of human bone marrow...
Immunofluorescence (IF) image for anti-Endothelin 2 (EDN2) antibody (ABIN4308204) Immunocytochemistry/Immunofluorescence: Endothelin 2 Antibody - Immunofluorescent st...