anti-Human IL21 antibody for Immunohistochemistry

Recommended IL21 Antibody (supplied by: Log in to see )

Antigen
Interleukin 21 (IL21) Antibodies
  • IL-21
  • Za11
  • interleukin 21
  • IL21
  • Il21
Epitope
N-Term
23
18
15
13
7
7
6
6
6
5
3
3
3
3
3
3
2
2
2
2
2
2
1
1
1
1
1
1
1
Reactivity
Human
206
105
24
9
4
4
4
1
1
Host
Goat
168
73
41
9
5
Clonality
Polyclonal
Conjugate
This IL21 antibody is un-conjugated
23
15
13
11
10
9
6
6
5
5
5
3
3
3
3
3
3
3
3
3
3
1
1
1
1
1
1
Application
Immunohistochemistry (Paraffin-embedded Sections) (IHC (p)), Immunohistochemistry (IHC), ELISA
189
138
49
38
34
25
14
13
7
6
5
4
4
4
3
2
1
1
Supplier
Log in to see
Supplier Product No.
Log in to see
Request

Get this product for free

Submit your validation data for this product and get a full refund. I want to validate this product

Learn more

Available images

Catalog No. ABIN449981
Contact our Customer Service for availability and price in your country.
Relevance Score ABIN Application Conjugate Host Isotype Epitope Supplier Clonality References Details
8.905899 ABIN3198158 IC IF IHC WB Rabbit Log in to see Polyclonal 0
8.905899 ABIN2563408 IF IHC WB Rabbit IgG Log in to see Polyclonal 0
8.905899 ABIN1030836 IHC ELISA WB Rabbit Extracellular Domain Log in to see Polyclonal 0
1 ABIN315232 ICC IF IHC IHC (fro) IHC (p) WB Rabbit Center Log in to see Polyclonal 5
1 ABIN4324913 ICC IF IHC WB Mouse IgG1 kappa Log in to see 14k5H3 1
1 ABIN342791 ICC IHC ELISA Goat AA 71-102 Log in to see Polyclonal 0
1 ABIN1174928 ICC IHC WB Rabbit IgG AA 23-155 Log in to see Polyclonal 0
1 ABIN2883051 IF IHC WB Rabbit IgG Log in to see Polyclonal 0
1 ABIN4324912 ICC IF IHC WB Mouse IgG1 kappa Log in to see 14k5H3 0
1 ABIN1174931 ICC IF IHC WB FITC Rabbit IgG Log in to see Polyclonal 0
1 ABIN4995104 IHC IHC (fro) IHC (p) FITC Mouse IgG1 kappa Log in to see 14k5A9 0
1 ABIN4995103 ICC IF IHC FITC Mouse IgG1 kappa Log in to see 14k5H3 0
1 ABIN2290116 IHC WB Rabbit IgG Log in to see Polyclonal 0
1 ABIN2288630 IHC WB Rabbit IgG Log in to see Polyclonal 0
1 ABIN4225369 ICC IF IHC WB Biotin Mouse IgG1 kappa Log in to see 14k5H3 0
1 ABIN4225371 ICC IF IHC WB DyLight 680 Mouse IgG1 kappa Log in to see 14k5H3 0
1 ABIN4225374 ICC IF IHC WB DyLight 755 Mouse IgG1 kappa Log in to see 14k5H3 0
1 ABIN4225377 ICC IF IHC WB DyLight 550 Mouse IgG1 kappa Log in to see 14k5H3 0
1 ABIN4225378 ICC IF IHC WB DyLight 350 Mouse IgG1 kappa Log in to see 14k5H3 0
1 ABIN4225379 ICC IF IHC WB DyLight 405 Mouse IgG1 kappa Log in to see 14k5H3 0

General

Antigen Interleukin 21 (IL21) Antibodies
Epitope N-Term
(23), (18), (15), (13), (7), (7), (6), (6), (6), (5), (3), (3), (3), (3), (3), (3), (2), (2), (2), (2), (2), (2), (1), (1), (1), (1), (1), (1), (1)
Reactivity Human
(206), (105), (24), (9), (4), (4), (4), (1), (1)
Host Goat
(168), (73), (41), (9), (5)
Clonality
Polyclonal
Conjugate This IL21 antibody is un-conjugated
(23), (15), (13), (11), (10), (9), (6), (6), (5), (5), (5), (3), (3), (3), (3), (3), (3), (3), (3), (3), (3), (1), (1), (1), (1), (1), (1)
Application Immunohistochemistry (Paraffin-embedded Sections) (IHC (p)), Immunohistochemistry (IHC), ELISA
(189), (138), (49), (38), (34), (25), (14), (13), (7), (6), (5), (4), (4), (4), (3), (2), (1), (1)
Supplier Log in to see

Product Details anti-IL21 Antibody

Target Details IL21 Application Details Handling Images
Specificity Human IL-21
Purification Immunogen affinity purified
Immunogen Synthetic peptide 78 CFQKAQLKSANTGNNERIINVSIKKLKRKPPS 109 corresponding to N-terminus region of human IL-21

Target Details IL21

Product Details anti-IL21 Antibody Application Details Handling Images back to top
Antigen
Alternative Name IL-21 (IL21 Antibody Abstract)
Background Gene Symbol: IL21
Gene ID 59067
UniProt Q9HBE4
Pathways JAK-STAT Signaling, Regulation of Leukocyte Mediated Immunity, Positive Regulation of Immune Effector Process, Production of Molecular Mediator of Immune Response

Application Details

Product Details anti-IL21 Antibody Target Details IL21 Handling Images back to top
Application Notes ELISA 1:50000, Immunohistochemistry 1:250, Immunohistochemistry-Paraffin 1:250
Comment

The antibodies are intended for use in vitro experiments only. Our antibodies have not been tested nor are recommended for use in vivo.

Restrictions For Research Use only

Handling

Product Details anti-IL21 Antibody Target Details IL21 Application Details Images back to top
Format Liquid
Concentration 1.0 mg/mL
Buffer 10 mM KHPO4 and 0.14M NaCl
Buffer contains: 0.1 % Sodium Azide
Preservative Sodium azide
Precaution of Use This product contains Sodium azide: a POISONOUS AND HAZARDOUS SUBSTANCE which should be handled by trained staff only.
Handling Advice Avoid freeze-thaw cycles
Storage -20 °C
Storage Comment Store at -20°C. Avoid freeze-thaw cycles.

Images

Product Details anti-IL21 Antibody Target Details IL21 Application Details Handling back to top
Supplier Images
Immunohistochemistry (IHC) image for anti-Interleukin 21 (IL21) (N-Term) antibody (ABIN449981) Immunohistochemistry: IL-21 Antibody [NBP1-30074] - Human spleen human IL-21