anti-Monkey IL21 Receptor antibody for Immunohistochemistry (Paraffin-embedded Sections)

Recommended IL21 Receptor Antibody (supplied by: Log in to see )

Antigen
Interleukin 21 Receptor (IL21R) Antibodies
  • IL21R
  • il-21ra.a
  • CD360
  • NILR
  • interleukin 21 receptor
  • interleukin 21 receptor, tandem duplicate 1
  • IL21R
  • il21r.1
  • Il21r
Epitope
AA 35-65
15
14
12
9
9
8
4
3
2
2
2
2
2
2
1
1
Reactivity
Human, Monkey
118
62
38
2
1
Host
Goat
91
32
14
6
Clonality
Polyclonal
Conjugate
This IL21 Receptor antibody is un-conjugated
9
7
5
3
3
3
3
3
2
2
1
1
1
1
1
1
1
1
1
Application
ELISA, Immunohistochemistry (IHC), Immunohistochemistry (Paraffin-embedded Sections) (IHC (p))
71
45
41
33
13
12
5
4
4
4
4
2
2
2
Supplier
Log in to see
Supplier Product No.
Log in to see
Request

Get this product for free

Submit your validation data for this product and get a full refund. I want to validate this product

Learn more

Catalog No. ABIN1819422
$ 625.17
Plus shipping costs $45.00

General

Antigen Interleukin 21 Receptor (IL21R) Antibodies
Epitope AA 35-65
(15), (14), (12), (9), (9), (8), (4), (3), (2), (2), (2), (2), (2), (2), (1), (1)
Reactivity Human, Monkey
(118), (62), (38), (2), (1)
Host Goat
(91), (32), (14), (6)
Clonality
Polyclonal
Conjugate This IL21 Receptor antibody is un-conjugated
(9), (7), (5), (3), (3), (3), (3), (3), (2), (2), (1), (1), (1), (1), (1), (1), (1), (1), (1)
Application ELISA, Immunohistochemistry (IHC), Immunohistochemistry (Paraffin-embedded Sections) (IHC (p))
(71), (45), (41), (33), (13), (12), (5), (4), (4), (4), (4), (2), (2), (2)
Supplier Log in to see

Product Details anti-IL21 Receptor Antibody

Target Details IL21 Receptor Application Details Handling Images
Specificity Recognizes an epitope within the N-terminal (NT) region of human interleukin-21 receptor (IL-21R), a type I transmembrane protein and member of the type I cytokine receptor family, selectively expressed by lymphoid tissues, which acts as the receptor for IL-21. Interaction between IL-21R and IL-21 results in the activation of several downstream signalling molecules including JAK1 and STAT1, and plays an essential role in the differentiation and proliferation of B cells, T cells and natural killer (NK) cells.
Purification Affinity purified
Immunogen Synthetic peptide CILEMWNLHPSTLTLTWQDQYEELKDEATS corresponding to amino acids 35-65 within the N-terminal region of human IL-21R. Percent identity by BLAST analysis: Human, Orangutan, Monkey (100%), Chimpanzee, Gibbon (97%).

Type of Immunogen: Synthetic peptide
Isotype IgG
Plasmids, Primers & others

Target Details IL21 Receptor

Product Details anti-IL21 Receptor Antibody Application Details Handling Images back to top
Antigen
Alternative Name IL21 Receptor / IL21R (IL21R Antibody Abstract)
Background Name/Gene ID: IL21R
Family: Interleukin

Synonyms: IL21R, CD360, Interleukin 21 receptor, Interleukin-21 receptor, NILR, IL-21 receptor, CD360 antigen, IL-21R, IL21 Receptor, Novel interleukin receptor
Gene ID 50615
UniProt Q9HBE5
Pathways JAK-STAT Signaling

Application Details

Product Details anti-IL21 Receptor Antibody Target Details IL21 Receptor Handling Images back to top
Application Notes Approved: ELISA (1:50000), IHC, IHC-P (1:150)
Comment

Target Species of Antibody: Human

Restrictions For Research Use only

Handling

Product Details anti-IL21 Receptor Antibody Target Details IL21 Receptor Application Details Images back to top
Format Liquid
Concentration Lot specific
Buffer PBS, 0.1 % sodium azide
Preservative Sodium azide
Precaution of Use This product contains Sodium azide: a POISONOUS AND HAZARDOUS SUBSTANCE which should be handled by trained staff only.
Handling Advice Avoid repeated freezing and thawing.
Storage -20 °C
Storage Comment Store at -20°C. Avoid freeze-thaw cycles.