Get this product for free
Submit your validation data for this product and get a full refund. I want to validate this productRelevance Score | ABIN | Application | Conjugate | Host | Isotype | Epitope | Supplier | Clonality | References | Details |
---|---|---|---|---|---|---|---|---|---|---|
9.094567 | ABIN2421119 | IHC ELISA | Rabbit | IgG | Log in to see | Polyclonal | 0 | |||
9.094567 | ABIN2427703 | IHC ELISA | Rabbit | IgG | Log in to see | Polyclonal | 0 | |||
1 | ABIN1002623 | IHC ELISA WB | Rabbit | IgG | Extracellular Domain | Log in to see | Polyclonal | 4 | ||
1 | ABIN342780 | FACS IHC ELISA | Rabbit | AA 35-64 | Log in to see | Polyclonal | 0 | |||
1 | ABIN1905061 | FACS IHC ELISA | Rabbit | AA 35-64 | Log in to see | Polyclonal | 0 | |||
1 | ABIN2878712 | IHC WB | Rabbit | IgG | Log in to see | Polyclonal | 0 | |||
1 | ABIN4324918 | ELISA ICC IF IHC IHC (p) WB | Rabbit | Log in to see | Polyclonal | 0 | ||||
1 | ABIN4904042 | IHC WB | Rabbit | IgG | Log in to see | Polyclonal | 0 | |||
1 | ABIN2288646 | IHC ELISA | Rabbit | IgG | AA 35-46 | Log in to see | Polyclonal | 0 | ||
1 | ABIN2288648 | FACS IHC ELISA | Rabbit | IgG | N-Term | Log in to see | Polyclonal | 0 | ||
1 | ABIN1584598 | IHC ELISA WB | Rabbit | Log in to see | Polyclonal | 0 | ||||
1 | ABIN1886904 | IHC ELISA WB | Rabbit | AA 97-111 | Log in to see | Polyclonal | 0 | |||
1 | ABIN3048773 | IHC WB | Rabbit | Log in to see | Polyclonal | 0 |
General |
|
---|---|
Antigen | Interleukin 21 Receptor (IL21R) Antibodies |
Reactivity | Mouse (Murine) Alternatives |
Host | Rabbit Alternatives |
Clonality | |
Conjugate | This IL21 Receptor antibody is un-conjugated Alternatives |
Application |
Immunohistochemistry (Paraffin-embedded Sections) (IHC (p)), Immunohistochemistry (IHC), ELISA
Alternatives
|
Supplier | Log in to see |
Product Details anti-IL21 Receptor AntibodyTarget Details IL21 Receptor Application Details Handling Images |
|
Specificity | IL21 Receptor |
Purification | Immunogen affinity purified |
Immunogen | Synthetic peptide: CVLETRSPNPSILSLTWQDEYEELQDQETF, corresponding to N-term amino acids 35-65 of Mouse IL21 Receptor. |
Target Details IL21 ReceptorProduct Details anti-IL21 Receptor Antibody Application Details Handling Images back to top |
|
Antigen | |
Alternative Name | IL-21 R (IL21R Antibody Abstract) |
Background | Gene Symbol: IL21R |
Gene ID | 50615 |
Pathways | JAK-STAT Signaling |
Application DetailsProduct Details anti-IL21 Receptor Antibody Target Details IL21 Receptor Handling Images back to top |
|
Application Notes | ELISA 1:100000, Immunohistochemistry 1:10-1:500, Immunohistochemistry-Paraffin 1:10-1:500 |
Comment |
The antibodies are intended for use in vitro experiments only. Our antibodies have not been tested nor are recommended for use in vivo. |
Restrictions | For Research Use only |
HandlingProduct Details anti-IL21 Receptor Antibody Target Details IL21 Receptor Application Details Images back to top |
|
Format | Liquid |
Concentration | 1.0 mg/mL |
Buffer |
PBS ( pH 7.2) Buffer contains: 0.1 % Sodium Azide |
Preservative | Sodium azide |
Precaution of Use | This product contains Sodium azide: a POISONOUS AND HAZARDOUS SUBSTANCE which should be handled by trained staff only. |
Handling Advice | Avoid freeze-thaw cycles |
Storage | 4 °C,-20 °C |
Storage Comment | Store at 4°C short term. Aliquot and store at -20°C long term. Avoid freeze-thaw cycles. |
ImagesProduct Details anti-IL21 Receptor Antibody Target Details IL21 Receptor Application Details Handling back to top |
|
Supplier Images |