anti-Mouse (Murine) LIF antibody for Western Blotting

Recommended LIF Antibody (supplied by: Log in to see )

Antigen
Leukemia Inhibitory Factor (LIF) Antibodies
  • CDF
  • DIA
  • HILDA
  • MLPLI
  • LIF, interleukin 6 family cytokine
  • leukemia inhibitory factor
  • LIF
  • Lif
Reactivity
Human, Mouse (Murine), Rat (Rattus)
127
65
32
12
9
7
5
2
2
2
1
1
1
Host
Rabbit
98
36
19
8
2
2
Clonality
Polyclonal
Conjugate
This LIF antibody is un-conjugated
6
5
4
3
3
3
3
2
2
2
2
2
2
2
2
2
2
1
1
1
1
1
Application
Western Blotting (WB)
130
60
47
44
28
12
12
6
6
3
2
1
1
1
1
Options
Supplier
Log in to see
Supplier Product No.
Log in to see
Request

Get this product for free

Submit your validation data for this product and get a full refund. I want to validate this product

Learn more

Available images

Catalog No. ABIN634803
$ 473.93
Plus shipping costs $45.00
Relevance Score ABIN Application Conjugate Host Isotype Epitope Supplier Clonality References Details
13.819985 ABIN3042667 WB Rabbit IgG AA 175-194, C-Term Log in to see Polyclonal 7
12.572241 ABIN5539549 ELISA WB Goat Internal Region Log in to see Polyclonal 0
11.5 ABIN737046 IF (p) IHC (p) WB Rabbit IgG AA 177-202 Log in to see Polyclonal 1
9.319985 ABIN2785833 WB Rabbit N-Term Log in to see Polyclonal 2
9.319985 ABIN5692888 ELISA WB Rabbit AA 24-203 Log in to see Polyclonal 3
7.819985 ABIN1859654 ICC IHC WB Rabbit IgG AA 25-203 Log in to see Polyclonal 0
7.819985 ABIN2737109 WB Rabbit IgG Log in to see Polyclonal 0
7.819985 ABIN1030986 ELISA WB Rabbit Middle Region Log in to see Polyclonal 0
7.819985 ABIN2937402 IF/ICC IHC IP WB Rabbit AA 25-203 Log in to see Polyclonal 0
4.819985 ABIN2704959 WB Rabbit C-Term Log in to see Polyclonal 0
4.819985 ABIN2706472 WB Rabbit Center Log in to see Polyclonal 0
4.819985 ABIN1449476 EIA WB Goat Internal Region, AA 28-39 Log in to see Polyclonal 0
4.819985 ABIN2692576 IP ELISA WB Rabbit IgG AA 1-203 Log in to see Polyclonal 0
4.819985 ABIN5870520 ELISA IF/ICC WB Goat AA 28-39 Log in to see Polyclonal 0
4.819985 ABIN2971965 WB Rabbit C-Term Log in to see Polyclonal 0
4.819985 ABIN2563673 ELISA WB Goat IgG AA 28-39 Log in to see Polyclonal 0
4.819985 ABIN3031615 WB Rabbit IgG C-Term Log in to see Polyclonal 0
4 ABIN322131 WB Rabbit IgG N-Term Log in to see Polyclonal 0
1 ABIN5554270 EIA IF WB Rabbit Center Log in to see Polyclonal 0
1 ABIN1833996 ELISA WB Goat AA 28-39 Log in to see Polyclonal 0

General

Antigen Leukemia Inhibitory Factor (LIF) Antibodies
Reactivity Human, Mouse (Murine), Rat (Rattus)
(127), (65), (32), (12), (9), (7), (5), (2), (2), (2), (1), (1), (1)
Host Rabbit
(98), (36), (19), (8), (2), (2)
Clonality
Polyclonal
Conjugate This LIF antibody is un-conjugated
(6), (5), (4), (3), (3), (3), (3), (2), (2), (2), (2), (2), (2), (2), (2), (2), (2), (1), (1), (1), (1), (1)
Application Western Blotting (WB)
(130), (60), (47), (44), (28), (12), (12), (6), (6), (3), (2), (1), (1), (1), (1)
Supplier Log in to see

Product Details anti-LIF Antibody

Target Details LIF Application Details Handling Images
Purification Affinity purified
Immunogen LIF antibody was raised using a synthetic peptide corresponding to a region with amino acids KVLAAGVVPLLLVLHWKHGAGSPLPITPVNATCAIRHPCHNNLMNQIRSQ
Plasmids, Primers & others

Target Details LIF

Product Details anti-LIF Antibody Application Details Handling Images back to top
Antigen
Alternative Name LIF (LIF Antibody Abstract)
Background LIF is a pleiotropic cytokine with roles in several different systems. It is involved in the induction of hematopoietic differentiation in normal and myeloid leukemia cells, induction of neuronal cell differentiation, regulator of mesenchymal to epithelial conversion during kidney development, and may also have a role in immune tolerance at the maternal-fetal interface.
Molecular Weight 22 kDa (MW of target protein)
Pathways JAK-STAT Signaling, Positive Regulation of Peptide Hormone Secretion, Negative Regulation of Hormone Secretion, Stem Cell Maintenance, Growth Factor Binding

Application Details

Product Details anti-LIF Antibody Target Details LIF Handling Images back to top
Application Notes WB: 1 µg/mL
Optimal conditions should be determined by the investigator.
Comment

LIF Blocking Peptide, catalog no. 33R-4712, is also available for use as a blocking control in assays to test for specificity of this LIF antibody

Restrictions For Research Use only

Handling

Product Details anti-LIF Antibody Target Details LIF Application Details Images back to top
Format Lyophilized
Reconstitution Lyophilized powder. Add distilled water for a 1 mg/mL concentration of LIF antibody in PBS
Concentration Lot specific
Buffer PBS
Handling Advice Avoid repeated freeze/thaw cycles.
Storage 4 °C
Storage Comment Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Images

Product Details anti-LIF Antibody Target Details LIF Application Details Handling back to top
Supplier Images
Western Blotting (WB) image for anti-Leukemia Inhibitory Factor (LIF) antibody (ABIN634803) LIF antibody used at 1 ug/ml to detect target protein.