anti-Human RPS6KA6 antibody for Immunofluorescence

Recommended RPS6KA6 Antibody (supplied by: Log in to see )

Antigen
Ribosomal Protein S6 Kinase, 90kDa, Polypeptide 6 (RPS6KA6) Antibodies
  • 2610524K04Rik
  • RSK4
  • PP90RSK4
  • rps6ka6
  • wu:fj94b02
  • zgc:66139
  • ribosomal protein S6 kinase polypeptide 6
  • ribosomal protein S6 kinase, 90kDa, polypeptide 6
  • ribosomal protein S6 kinase, like
  • Rps6ka6
  • RPS6KA6
  • rps6kal
Reactivity
Human
43
6
5
2
Host
Rabbit
24
17
2
Clonality
Polyclonal
Application
Immunocytochemistry (ICC), Immunofluorescence (IF), Immunohistochemistry (IHC), Immunohistochemistry (Paraffin-embedded Sections) (IHC (p))
39
23
14
13
5
1
1
1
1
Supplier
Log in to see
Supplier Product No.
Log in to see
Request

Get this product for free

Submit your validation data for this product and get a full refund. I want to validate this product

Learn more

Available images

Catalog No. ABIN4351291
Contact our Customer Service for availability and price in your country.
Relevance Score ABIN Application Conjugate Host Isotype Epitope Supplier Clonality References Details
11.917223 ABIN4351290 ICC IF IHC IHC (p) WB Rabbit IgG Log in to see Polyclonal
11.917223 ABIN565376 IF ELISA WB Mouse IgG3 kappa AA 636-745, partial Log in to see 3G12
1 ABIN498435 IF IHC (p) WB Rabbit Log in to see Polyclonal
1 ABIN5587225 IF IHC (p) WB Rabbit IgG Log in to see Polyclonal
1 ABIN5587224 IF IHC Rabbit IgG Log in to see Polyclonal

General

Antigen Ribosomal Protein S6 Kinase, 90kDa, Polypeptide 6 (RPS6KA6) Antibodies
Reactivity Human
(43), (6), (5), (2)
Host Rabbit
(24), (17), (2)
Clonality
Polyclonal
Application Immunocytochemistry (ICC), Immunofluorescence (IF), Immunohistochemistry (IHC), Immunohistochemistry (Paraffin-embedded Sections) (IHC (p))
(39), (23), (14), (13), (5), (1), (1), (1), (1)
Supplier Log in to see

Product Details anti-RPS6KA6 Antibody

Target Details RPS6KA6 Application Details Handling Images
Specificity Specificity of antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins.
Purification Immunogen affinity purified
Immunogen This antibody was developed against Recombinant Protein corresponding to amino acids:PFKPASGKPDDTFCFDPEFTAKTPKDSPGLPASANAHQLFKGFSFVATSIAEEYKITPITSANVLPIVQINGNAAQFGEVYELKEDIGVGSYSVCKRCIHATTNMEFAVKIIDKSK
Isotype IgG

Target Details RPS6KA6

Product Details anti-RPS6KA6 Antibody Application Details Handling Images back to top
Antigen
Alternative Name RSK4 (RPS6KA6 Antibody Abstract)
Background Gene Symbol: RPS6KA6
Gene ID 27330
Research Area Signaling
Pathways MAPK Signaling

Application Details

Product Details anti-RPS6KA6 Antibody Target Details RPS6KA6 Handling Images back to top
Application Notes Immunohistochemistry, Immunocytochemistry/Immunofluorescence 1 - 4 μg/mL, Immunohistochemistry-Paraffin 1:20 - 1:50This antibody is useful for Immunohistochemistry-Paraffin. For HIER pH 6 retrieval is recommended.
Comment

The antibodies are intended for use in vitro experiments only. Our antibodies have not been tested nor are recommended for use in vivo.

Restrictions For Research Use only

Handling

Product Details anti-RPS6KA6 Antibody Target Details RPS6KA6 Application Details Images back to top
Format Liquid
Buffer PBS ( pH 7.2) and 40 % Glycerol
Buffer contains: 0.02 % Sodium Azide
Preservative Sodium azide
Precaution of Use This product contains Sodium azide: a POISONOUS AND HAZARDOUS SUBSTANCE which should be handled by trained staff only.
Storage 4 °C,-20 °C
Storage Comment Store at 4°C short term. Aliquot and store at -20°C long term. Avoid freeze-thaw cycles.

Images

Product Details anti-RPS6KA6 Antibody Target Details RPS6KA6 Application Details Handling back to top
Supplier Images
Immunohistochemistry (Paraffin-embedded Sections) (IHC (p)) image for anti-Ribosomal Protein S6 Kinase, 90kDa, Polypeptide 6 (RPS6KA6) antibody (ABIN4351291) Immunohistochemistry-Paraffin: RSK4 Antibody [NBP1-87108] - Staining of human stomach...
Immunofluorescence (IF) image for anti-Ribosomal Protein S6 Kinase, 90kDa, Polypeptide 6 (RPS6KA6) antibody (ABIN4351291) Immunocytochemistry/Immunofluorescence: RSK4 Antibody [NBP1-87108] - Staining of huma...
Immunofluorescence (IF) image for anti-Ribosomal Protein S6 Kinase, 90kDa, Polypeptide 6 (RPS6KA6) antibody (ABIN4351291) Immunocytochemistry/Immunofluorescence: RSK4 Antibody - Immunofluorescent staining o...