anti-Human Spastin antibody for Immunohistochemistry (Paraffin-embedded Sections)

Recommended Spastin Antibody (supplied by: Log in to see )

Antigen
Spastin (SPAST) Antibodies
  • CG5977
  • D-spastin
  • Dmel\\CG5977
  • Dspastin
  • Spas
  • zgc:85952
  • SPAST
  • spg4
  • LOC100224472
  • ADPSP
  • FSP2
  • SPG4
  • Spg4
  • mKIAA1083
  • spastin
  • spastin S homeolog
  • spas
  • spast
  • SPAST
  • Spast
  • spast.S
Reactivity
Human, Rat (Rattus)
61
45
44
3
2
2
2
2
2
1
1
1
1
1
1
1
Host
Rabbit
47
14
Clonality
Polyclonal
Conjugate
This Spastin antibody is un-conjugated
2
2
2
2
2
2
2
2
2
2
2
2
2
2
2
2
2
2
Application
Immunohistochemistry (IHC), Immunohistochemistry (Paraffin-embedded Sections) (IHC (p)), Western Blotting (WB)
54
54
20
6
2
2
2
1
1
Supplier
Log in to see
Supplier Product No.
Log in to see
Request

Get this product for free

Submit your validation data for this product and get a full refund. I want to validate this product

Learn more

Available images

Catalog No. ABIN4355519
Contact our Customer Service for availability and price in your country.
Relevance Score ABIN Application Conjugate Host Isotype Epitope Supplier Clonality References Details
1 ABIN790592 IHC (p) ELISA WB Mouse IgG1, kappa AA 200-305 Log in to see 2F5 0
1 ABIN520426 IF IHC (p) ELISA WB Mouse IgG1 kappa AA 200-304, partial Log in to see 2F5 0

General

Antigen Spastin (SPAST) Antibodies
Reactivity Human, Rat (Rattus)
(61), (45), (44), (3), (2), (2), (2), (2), (2), (1), (1), (1), (1), (1), (1), (1)
Host Rabbit
(47), (14)
Clonality
Polyclonal
Conjugate This Spastin antibody is un-conjugated
(2), (2), (2), (2), (2), (2), (2), (2), (2), (2), (2), (2), (2), (2), (2), (2), (2), (2)
Application Immunohistochemistry (IHC), Immunohistochemistry (Paraffin-embedded Sections) (IHC (p)), Western Blotting (WB)
(54), (54), (20), (6), (2), (2), (2), (1), (1)
Supplier Log in to see

Product Details anti-Spastin Antibody

Target Details Spastin Application Details Handling Images
Specificity Specificity of antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins.
Purification Immunogen affinity purified
Immunogen This antibody was developed against Recombinant Protein corresponding to amino acids:KRKDPLTHTSNSLPRSKTVMKTGSAGLSGHHRAPSYSGLSMVSGVKQGSGPAPTTHKGTPKTNRTNKPSTPTTATRKKKDLKNFRNVDSNLANLIMNEIVDNGTAVKFDDIAGQDLAKQALQEIVILPSLRPELFTGL
Isotype IgG

Target Details Spastin

Product Details anti-Spastin Antibody Application Details Handling Images back to top
Antigen
Alternative Name Spastin (SPAST Antibody Abstract)
Background Gene Symbol: SPAST
Gene ID 6683
Pathways Microtubule Dynamics, M Phase, Regulation of Cell Size

Application Details

Product Details anti-Spastin Antibody Target Details Spastin Handling Images back to top
Application Notes Western Blot 1:100 - 1:250, Immunohistochemistry, Immunohistochemistry-Paraffin 1:200 - 1:500For IHC-Paraffin HIER pH 6 retrieval is recommended.
Comment

The antibodies are intended for use in vitro experiments only. Our antibodies have not been tested nor are recommended for use in vivo.

Restrictions For Research Use only

Handling

Product Details anti-Spastin Antibody Target Details Spastin Application Details Images back to top
Format Liquid
Buffer PBS ( pH 7.2) and 40 % Glycerol
Buffer contains: 0.02 % Sodium Azide
Preservative Sodium azide
Precaution of Use This product contains Sodium azide: a POISONOUS AND HAZARDOUS SUBSTANCE which should be handled by trained staff only.
Storage 4 °C,-20 °C
Storage Comment Store at 4°C short term. Aliquot and store at -20°C long term. Avoid freeze-thaw cycles.

Images

Product Details anti-Spastin Antibody Target Details Spastin Application Details Handling back to top
Supplier Images
Immunohistochemistry (Paraffin-embedded Sections) (IHC (p)) image for anti-Spastin (SPAST) antibody (ABIN4355519) Immunohistochemistry-Paraffin: Spastin Antibody [NBP1-90230] - Immunohistochemical st...
Western Blotting (WB) image for anti-Spastin (SPAST) antibody (ABIN4355519) Western Blot: Spastin Antibody [NBP1-90230] - Lane 1: Marker [kDa] 230, 130, 95, 72, ...
Western Blotting (WB) image for anti-Spastin (SPAST) antibody (ABIN4355519) Western Blot: Spastin Antibody [NBP1-90230] - Lane 1: NIH-3T3 cell lysate (Mouse embr...
Immunofluorescence (IF) image for anti-Spastin (SPAST) antibody (ABIN4355519) Immunocytochemistry/Immunofluorescence: Spastin Antibody - Immunofluorescent stainin...