anti-Human Insulin antibody for Immunohistochemistry (Paraffin-embedded Sections)

Recommended Insulin Antibody (supplied by: Log in to see )

Insulin (INS) Antibodies
  • ins1
  • xins
  • ins1-a
  • Insulin
  • IDDM2
  • ILPR
  • IRDN
  • MODY10
  • AA986540
  • Ins-2
  • InsII
  • Mody
  • Mody4
  • proinsulin
  • zgc:109842
  • insulin
  • insulin precursor
  • insulin II
  • preproinsulin
  • ins
  • PIN
  • INS
  • Ins
  • INS-IGF2
  • Ins2
This Insulin antibody is un-conjugated
Immunohistochemistry (IHC), Immunohistochemistry (Paraffin-embedded Sections) (IHC (p)), Western Blotting (WB)
Log in to see
Supplier Product No.
Log in to see

Get this product for free

Submit your validation data for this product and get a full refund. I want to validate this product

Learn more

Available images

Catalog No. ABIN4326017
Contact our Customer Service for availability and price in your country.
Relevance Score ABIN Application Conjugate Host Isotype Epitope Supplier Clonality References Details
12.833679 ABIN316680 EIA IHC (p) Mouse IgG1 Log in to see 2D11 0
12.833679 ABIN260218 IHC (p) IHC ELISA Mouse IgG1 Log in to see 2D11 0
12.833679 ABIN337134 IHC (p) ELISA HRP Mouse IgG1, kappa Log in to see 8E2 0
12.833679 ABIN214027 IHC (p) ELISA WB Mouse IgG1, kappa Log in to see 2D11-H5 0
12.833679 ABIN269653 DB ICC IF IHC (p) IHC RIA Mouse IgG1 Log in to see K36aC10 0
12.833679 ABIN461989 IHC (p) ELISA Mouse IgG1 Log in to see 0
12.833679 ABIN396953 IHC (p) Mouse IgG1, kappa Log in to see 0
12.833679 ABIN448377 IHC (p) IHC Mouse IgG1 Log in to see ISL-8J 0
12.833679 ABIN337249 FACS ICC IF IHC (p) Rabbit IgG Log in to see Polyclonal 0
12.833679 ABIN261237 ELISA IHC (p) Mouse IgG1 kappa Log in to see 8E2 0
12.833679 ABIN498557 IHC (p) Rabbit Log in to see Polyclonal 0
12.833679 ABIN4326016 FACS ICC IF IHC (p) Rabbit IgG Log in to see Polyclonal 0
1 ABIN3043651 IHC (p) Mouse IgG1 Log in to see K36AC10 20
1 ABIN372838 EIA FACS IF IHC (p) Rabbit IgG Log in to see Polyclonal 3
1 ABIN112214 EIA IHC (fro) IHC (p) Mouse IgG1 Log in to see D3E7 (5B6-6) 1
1 ABIN255726 IHC (fro) IHC (p) IHC ELISA Mouse IgG1 Log in to see D3E7 (5B6-6) 0
1 ABIN768892 IHC (fro) IHC (p) ELISA Mouse IgG1 Log in to see D3E7 0
1 ABIN1804387 IHC (fro) IHC (p) ELISA Mouse IgG1 Log in to see E2E3 0
1 ABIN1804388 IHC (fro) IHC (p) ELISA Mouse IgG1 Log in to see D3E7 (5B6-6) 0
1 ABIN1107760 IHC (p) IP Mouse IgG1 Log in to see ISL-8J 1


Antigen Insulin (INS) Antibodies
Reactivity Human
(876), (392), (263), (258), (207), (120), (49), (6), (6), (6), (5), (4), (4), (2), (2), (1), (1), (1), (1), (1), (1), (1)
Host Rabbit
(709), (178), (53), (16), (3), (1)
Conjugate This Insulin antibody is un-conjugated
(47), (38), (37), (23), (22), (22), (22), (17), (17), (14), (14), (14), (14), (14), (14), (14), (14), (10), (9), (8), (8), (8), (5), (5), (5), (5), (5), (5), (2), (1)
Application Immunohistochemistry (IHC), Immunohistochemistry (Paraffin-embedded Sections) (IHC (p)), Western Blotting (WB)
(507), (352), (228), (204), (190), (181), (147), (124), (66), (64), (33), (26), (15), (11), (8), (6), (5), (4), (4), (3), (3), (2), (2), (1), (1), (1), (1), (1)
Pubmed 2 references available
Supplier Log in to see

Product Details anti-Insulin Antibody

Target Details Insulin Application Details Handling References for anti-Insulin antibody (ABIN4326017) Images
Specificity Specificity of antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins.
Purification Immunogen affinity purified
Immunogen This antibody was developed against Recombinant Protein corresponding to amino acids:SHLVEALYLVCGERGFFYTPKTRREAEDLQVGQVELGGGPGAGSLQPLALEGSLQKRGIVEQCCTSICSLYQLENYC
Isotype IgG

Target Details Insulin

Product Details anti-Insulin Antibody Application Details Handling References for anti-Insulin antibody (ABIN4326017) Images back to top
Alternative Name Insulin (INS Antibody Abstract)
Background Gene Symbol: INS
Gene ID 3630
Pathways NF-kappaB Signaling, RTK Signaling, Positive Regulation of Peptide Hormone Secretion, Peptide Hormone Metabolism, Hormone Activity, Carbohydrate Homeostasis, ER-Nucleus Signaling, Regulation of Carbohydrate Metabolic Process, Feeding Behaviour, Autophagy, Negative Regulation of intrinsic apoptotic Signaling, Brown Fat Cell Differentiation, Positive Regulation of fat Cell Differentiation

Application Details

Product Details anti-Insulin Antibody Target Details Insulin Handling References for anti-Insulin antibody (ABIN4326017) Images back to top
Application Notes Western Blot 1:100-1:500, Immunohistochemistry, Immunohistochemistry-Paraffin 1:200-1:500For IHC-Paraffin HIER pH 6 retrieval is recommended.

The antibodies are intended for use in vitro experiments only. Our antibodies have not been tested nor are recommended for use in vivo.

Restrictions For Research Use only


Product Details anti-Insulin Antibody Target Details Insulin Application Details References for anti-Insulin antibody (ABIN4326017) Images back to top
Format Liquid
Buffer PBS ( pH 7.2) and 40 % Glycerol
Buffer contains: 0.02 % Sodium Azide
Preservative Sodium azide
Precaution of Use This product contains Sodium azide: a POISONOUS AND HAZARDOUS SUBSTANCE which should be handled by trained staff only.
Storage 4 °C,-20 °C
Storage Comment Store at 4°C short term. Aliquot and store at -20°C long term. Avoid freeze-thaw cycles.

References for anti-Insulin antibody (ABIN4326017)

Product Details anti-Insulin Antibody Target Details Insulin Application Details Handling Images back to top
Product cited in:

Lindskog, Korsgren, Pontén, Eriksson, Johansson, Danielsson: "Novel pancreatic beta cell-specific proteins: antibody-based proteomics for identification of new biomarker candidates." in: Journal of proteomics, Vol. 75, Issue 9, pp. 2611-20, 2012

Lindskog, Asplund, Engkvist, Uhlen, Korsgren, Ponten: "Antibody-based proteomics for discovery and exploration of proteins expressed in pancreatic islets." in: Discovery medicine, Vol. 9, Issue 49, pp. 565-78, 2010


Product Details anti-Insulin Antibody Target Details Insulin Application Details Handling References for anti-Insulin antibody (ABIN4326017) back to top
Supplier Images
Immunohistochemistry (Paraffin-embedded Sections) (IHC (p)) image for anti-Insulin (INS) antibody (ABIN4326017) Immunohistochemistry-Paraffin: Insulin Antibody [NBP1-87485] - Staining of human panc...
Western Blotting (WB) image for anti-Insulin (INS) antibody (ABIN4326017) Western Blot: Insulin Antibody [NBP1-87485] - Lane 1: Marker [kDa] 250, 130, 95, 72, ...
Western Blotting (WB) image for anti-Insulin (INS) antibody (ABIN4326017) Western Blot: Insulin Antibody - Analysis in control (3.1 kDa) in mammalian HEK293T ...
Immunohistochemistry (Paraffin-embedded Sections) (IHC (p)) image for anti-Insulin (INS) antibody (ABIN4326017) Immunohistochemistry-Paraffin: Insulin Antibody - Staining of human pancreas shows h...
Immunohistochemistry (Paraffin-embedded Sections) (IHC (p)) image for anti-Insulin (INS) antibody (ABIN4326017) Immunohistochemistry-Paraffin: Insulin Antibody - Staining of human liver shows low ...
Immunohistochemistry (Paraffin-embedded Sections) (IHC (p)) image for anti-Insulin (INS) antibody (ABIN4326017) Immunohistochemistry-Paraffin: Insulin Antibody - Staining in human pancreas and liv...