anti-Mouse (Murine) BAX antibody for Western Blotting

Recommended BAX Antibody (supplied by: Log in to see )

BCL2-Associated X Protein (BAX) Antibodies
  • bax-A
  • xBax
  • xlbax
  • BAX
  • bax
  • fj16e01
  • wu:fc50b10
  • wu:fj16e01
  • BCL2L4
  • BCL2 associated X, apoptosis regulator
  • BCL2-associated X protein L homeolog
  • BCL2-associated X protein
  • bcl2-associated X protein, a
  • BAX
  • bax.L
  • bax
  • baxa
  • Bax
AA 17-48, N-Term
Human, Mouse (Murine), Rat (Rattus)
This BAX antibody is un-conjugated
Immunohistochemistry (Paraffin-embedded Sections) (IHC (p)), Western Blotting (WB)
Log in to see
Supplier Product No.
Log in to see

Get this product for free

Submit your validation data for this product and get a full refund. I want to validate this product

Learn more

Available images

Catalog No. ABIN5518740
$ 280.00
Plus shipping costs $45.00
Relevance Score ABIN Application Conjugate Host Isotype Epitope Supplier Clonality References Details
33.28973 ABIN725390 FACS IF (cc) IF (p) IHC (p) WB Rabbit IgG AA 60-110 Log in to see Polyclonal 24
24.28973 ABIN6260205 ELISA ICC IF IHC WB Rabbit IgG Log in to see Polyclonal 11
23.018665 ABIN3183487 ELISA IHC WB Rabbit IgG N-Term Log in to see Polyclonal 0
20.018665 ABIN3183484 ELISA IF IHC WB Rabbit IgG Internal Region Log in to see Polyclonal 0
20.018665 ABIN6254209 IF WB Goat IgG N-Term Log in to see Polyclonal 0
20.018665 ABIN870624 IP ELISA WB Rabbit N-Term Log in to see GL8-R 0
17.728935 ABIN3020683 IHC WB Rabbit IgG Log in to see Polyclonal 3
17.018665 ABIN3183486 ELISA IF WB Rabbit IgG Ser165 Log in to see Polyclonal 0
13.789729 ABIN1848438 IHC ELISA WB Rabbit N-Term Log in to see Polyclonal 0
13.228935 ABIN4901052 IHC (p) WB Mouse IgG1 AA 30-110 Log in to see 1C1 0
13.228935 ABIN4901051 IHC (p) WB Mouse IgG1 AA 30-110 Log in to see 6F11 0
13.228935 ABIN135028 WB Mouse IgG1 AA 12-24 Log in to see 6A7 3
13.228935 ABIN135026 IP ELISA WB Mouse IgG1 AA 3-16 Log in to see 5B7 3
13.228935 ABIN2134508 WB Mouse IgG1 kappa Log in to see 6A7 0
13.228935 ABIN1689871 WB Rabbit Log in to see Polyclonal 0
12.292006 ABIN4283102 IHC IHC (p) WB Rabbit IgG Log in to see Polyclonal 2
12.289729 ABIN682843 IF (p) IHC (p) WB Rabbit IgG AA 179-192, pSer184 Log in to see Polyclonal 5
12.289729 ABIN6260204 ELISA ICC IF WB Rabbit IgG Log in to see Polyclonal 3
10.789729 ABIN2705573 IC IF IHC WB Rabbit Center Log in to see Polyclonal 0
10.789729 ABIN1534426 IF IHC ELISA WB Rabbit IgG AA 41-90 Log in to see Polyclonal 2


Antigen BCL2-Associated X Protein (BAX) Antibodies
Epitope AA 17-48, N-Term
(86), (65), (31), (22), (21), (18), (15), (12), (12), (12), (11), (10), (9), (9), (9), (7), (7), (5), (4), (4), (3), (3), (3), (3), (3), (3), (2), (2), (2), (2), (2), (2), (2), (2), (1), (1), (1), (1), (1), (1), (1), (1), (1), (1), (1), (1), (1), (1), (1), (1), (1), (1)
Reactivity Human, Mouse (Murine), Rat (Rattus)
(546), (233), (212), (117), (43), (31), (28), (23), (20), (11), (7), (7), (6), (5), (3), (3), (3), (2), (2), (2), (1), (1), (1), (1), (1)
Host Rabbit
(350), (231), (5), (2)
Conjugate This BAX antibody is un-conjugated
(19), (15), (13), (12), (11), (9), (8), (6), (4), (3), (3), (3), (3), (3), (3), (3), (3), (3), (3), (2), (2), (2), (2), (2), (2), (2), (2), (2), (2), (2), (2), (2), (2), (2), (2), (2), (2), (2), (2), (2), (2), (2), (2), (2)
Application Immunohistochemistry (Paraffin-embedded Sections) (IHC (p)), Western Blotting (WB)
(455), (220), (195), (168), (141), (137), (114), (45), (42), (39), (30), (26), (13), (5), (5), (2), (1), (1), (1), (1), (1), (1), (1)
Pubmed 69 references available
Supplier Log in to see

Product Details anti-BAX Antibody

Target Details BAX Application Details Handling References for anti-BAX antibody (ABIN5518740) Images
Purpose Rabbit IgG polyclonal antibody for Apoptosis regulator BAX(BAX) detection. Tested with WB, IHC-P in Human,Mouse,Rat.
Cross-Reactivity (Details) No cross reactivity with other proteins.
Characteristics Rabbit IgG polyclonal antibody for Apoptosis regulator BAX(BAX) detection. Tested with WB, IHC-P in Human,Mouse,Rat.
Gene Name: BCL2-associated X protein
Protein Name: Apoptosis regulator BAX
Purification Immunogen affinity purified.
Immunogen A synthetic peptide corresponding to a sequence at the N-terminus of human Bax (17-48aa EQIMKTGALLLQGFIQDRAGRMGGEAPELALD), different from the related mouse and rat sequences by five amino acids.
Isotype IgG
Plasmids, Primers & others

Target Details BAX

Product Details anti-BAX Antibody Application Details Handling References for anti-BAX antibody (ABIN5518740) Images back to top
Alternative Name BAX (BAX Antibody Abstract)
Background Apoptosis regulator BAX, also known as bcl-2-like protein 4, is a protein that in humans is encoded by the BAX gene. The protein encoded by this gene belongs to the BCL2 protein family. BCL2 family members form hetero- or homodimers and act as anti- or pro-apoptotic regulators that are involved in a wide variety of cellular activities. This protein forms a heterodimer with BCL2, and functions as an apoptotic activator. Additionally, this protein is reported to interact with, and increase the opening of, the mitochondrial voltage-dependent anion channel (VDAC), which leads to the loss in membrane potential and the release of cytochrome c. The expression of this gene is regulated by the tumor suppressor P53 and has been shown to be involved in P53-mediated apoptosis. Multiple alternatively spliced transcript variants, which encode different isoforms, have been reported for this gene.

Synonyms: Apoptosis regulator BAX | BAXA | Bcl2-L-4 | BCL2L4 | Bcl-2-like protein 4 | Q07812
Gene ID 581
UniProt Q07812
Pathways p53 Signaling, PI3K-Akt Signaling, Apoptosis, Caspase Cascade in Apoptosis, Positive Regulation of Endopeptidase Activity, Unfolded protein response

Application Details

Product Details anti-BAX Antibody Target Details BAX Handling References for anti-BAX antibody (ABIN5518740) Images back to top
Application Notes WB: Concentration: 0.1-0.5 μg/mL, Tested Species: Human, Mouse, Rat
IHC-P: Concentration: 0.5-1 μg/mL, Tested Species: Human, Mouse, Rat, Epitope Retrieval by Heat: Boiling the paraffin sections in 10 mM citrate buffer, pH 6.0, for 20 mins is required for the staining of formalin/paraffin sections.
Notes: Tested Species: Species with positive results. Other applications have not been tested. Optimal dilutions should be determined by end users.

Antibody can be supported by chemiluminescence kit ABIN921124 in WB, supported by ABIN921231 in IHC(P).

Restrictions For Research Use only


Product Details anti-BAX Antibody Target Details BAX Application Details References for anti-BAX antibody (ABIN5518740) Images back to top
Format Lyophilized
Reconstitution Add 0.2 mL of distilled water will yield a concentration of 500 μg/mL.
Concentration 500 μg/mL
Buffer Each vial contains 5 mg BSA, 0.9 mg NaCl, 0.2 mg Na2HPO4, 0.05 mg Sodium azide.
Preservative Sodium azide
Precaution of Use This product contains Sodium azide: a POISONOUS AND HAZARDOUS SUBSTANCE which should be handled by trained staff only.
Storage 4 °C,-20 °C
Storage Comment At -20°C for one year. After reconstitution, at 4°C for one month.
It can also be aliquotted and stored frozen at -20 °C for a longer time. Avoid repeated freezing and thawing.

References for anti-BAX antibody (ABIN5518740)

Product Details anti-BAX Antibody Target Details BAX Application Details Handling Images back to top
Product cited in:

Liu, Kuang, Wu, Jin, Sun: "A novel polysaccharide from Sargassum integerrimum induces apoptosis in A549 cells and prevents angiogensis in vitro and in vivo." in: Scientific reports, Vol. 6, pp. 26722, 2018

Guo, Lin, Shao, Rong, Zhang: "BMP‑7 suppresses excessive scar formation by activating the BMP‑7/Smad1/5/8 signaling pathway." in: Molecular medicine reports, Vol. 16, Issue 2, pp. 1957-1963, 2018

Guo, Guo, Zhao, Cai: "Active targeting co-delivery system based on hollow mesoporous silica nanoparticles for antitumor therapy in ovarian cancer stem-like cells." in: Oncology reports, Vol. 38, Issue 3, pp. 1442-1450, 2018

Cui, Li, Xu, Zhang, Sun, Chen: "Emodin alleviates severe acute pancreatitis-associated acute lung injury by decreasing pre-B-cell colony-enhancing factor expression and promoting polymorphonuclear neutrophil apoptosis." in: Molecular medicine reports, Vol. 16, Issue 4, pp. 5121-5128, 2018

Chen, Zhu, Yang, Wei, Chen, He, Ji: "Ailanthone induces G2/M cell cycle arrest and apoptosis of SGC‑7901 human gastric cancer cells." in: Molecular medicine reports, Vol. 16, Issue 5, pp. 6821-6827, 2018

Liang, Zhong, Gong, Wang, Zhu, Liu, Yang et al.: "Fibroblast growth factor 21 protects rat cardiomyocytes from endoplasmic reticulum stress by promoting the fibroblast growth factor receptor 1-extracellular signal‑regulated kinase 1/2 signaling ..." in: International journal of molecular medicine, Vol. 40, Issue 5, pp. 1477-1485, 2018

Wu, Zhang, Song, Song, Zhang, Zhang, Han, Zhang, Chu: "Magnesium isoglycyrrhizinate ameliorates doxorubicin-induced acute cardiac and hepatic toxicity via anti-oxidant and anti-apoptotic mechanisms in mice." in: Experimental and therapeutic medicine, Vol. 15, Issue 1, pp. 1005-1012, 2018

Cui, Wu, Lv, Zhang, Bai, Cao: "Down-regulation of long non-coding RNA ESCCAL_1 inhibits tumor growth of esophageal squamous cell carcinoma in a xenograft mouse model." in: Oncotarget, Vol. 9, Issue 1, pp. 783-790, 2018

An, Liu, She, Wu, Tian, Shi, Hao, Ren, Yang, Lu, Yang, Wu: "Replication of hepatitis E virus in the ovary and promotion of oocyte apoptosis in rabbits infected with HEV-4." in: Oncotarget, Vol. 9, Issue 4, pp. 4475-4484, 2018

Bai, Yang, Luo: "Effects of 5-hydroxy-4'-nitro-7-propionyloxy-genistein on inhibiting proliferation and invasion via activating reactive oxygen species in human ovarian cancer A2780/DDP cells." in: Oncology letters, Vol. 15, Issue 4, pp. 5227-5235, 2018

Yang, Shi, Soomro, Hu, Du, She: "Hepatitis E Virus Induces Hepatocyte Apoptosis via Mitochondrial Pathway in Mongolian Gerbils." in: Frontiers in microbiology, Vol. 9, pp. 460, 2018

Wang, Li, Yang, Gao, Lin, Wang, Zhou, Hu: "Ginsenoside Rb1 inhibit apoptosis in rat model of Alzheimer's disease induced by Aβ1-40." in: American journal of translational research, Vol. 10, Issue 3, pp. 796-805, 2018

Qi, Xue, Lv, Sun, Du, Cai, Li, Gu, Wang: "Ginkgolic acids induce HepG2 cell death via a combination of apoptosis, autophagy and the mitochondrial pathway." in: Oncology letters, Vol. 15, Issue 5, pp. 6400-6408, 2018

Wei, Wang, Chen, Yin, Jiang, Liu, Chen, Sun: "Yangyin Fuzheng Decoction enhances anti-tumor efficacy of cisplatin on lung cancer." in: Journal of Cancer, Vol. 9, Issue 9, pp. 1568-1574, 2018

Guo, Fu, Wang, Wang, Li, Huang, Gao, Li: "Di-2-pyridylhydrazone Dithiocarbamate Butyric Acid Ester Exerted Its Proliferative Inhibition against Gastric Cell via ROS-Mediated Apoptosis and Autophagy." in: Oxidative medicine and cellular longevity, Vol. 2018, pp. 4950705, 2018

Hu, Sun, Zhang, Zhang, Hu: "Catalpol inhibits apoptosis in hydrogen peroxide-induced cardiac myocytes through a mitochondrial-dependent caspase pathway." in: Bioscience reports, Vol. 36, Issue 3, 2017

Guo, Wang, Gao, Zhang, Chen, Xu, Hu, Jing, Jing, Li, Wang, Zhu: "Knockdown of High Mobility Group-Box 3 (HMGB3) Expression Inhibits Proliferation, Reduces Migration, and Affects Chemosensitivity in Gastric Cancer Cells." in: Medical science monitor : international medical journal of experimental and clinical research, Vol. 22, pp. 3951-3960, 2017

Niu, Zhang, Zhang, Zhuang, Zhan, Chen, Du, Yin, You, Li, Guan: "Inhibition by Multifunctional Magnetic Nanoparticles Loaded with Alpha-Synuclein RNAi Plasmid in a Parkinson's Disease Model." in: Theranostics, Vol. 7, Issue 2, pp. 344-356, 2017

Ustarroz-Cano, Garcia-Pelaez, Cervantes-Yepez, Lopez-Valdez, Fortoul: "Thymic cytoarchitecture changes in mice exposed to vanadium." in: Journal of immunotoxicology, Vol. 14, Issue 1, pp. 9-14, 2017

Hu, Du, Li, Gao, Chen, Yu: "Inhibition of cerebral ischemia/reperfusion injury-induced apoptosis: nicotiflorin and JAK2/STAT3 pathway." in: Neural regeneration research, Vol. 12, Issue 1, pp. 96-102, 2017


Product Details anti-BAX Antibody Target Details BAX Application Details Handling References for anti-BAX antibody (ABIN5518740) back to top
Supplier Images
Western Blotting (WB) image for anti-BCL2-Associated X Protein (BAX) (AA 17-48), (N-Term) antibody (ABIN5518740) Western blot analysis of Bax using anti-Bax antibody . Electrophoresis was performed...
Immunohistochemistry (IHC) image for anti-BCL2-Associated X Protein (BAX) (AA 17-48), (N-Term) antibody (ABIN5518740) IHC analysis of Bax using anti-Bax antibody . Bax was detected in paraffin-embedded s...
Immunohistochemistry (IHC) image for anti-BCL2-Associated X Protein (BAX) (AA 17-48), (N-Term) antibody (ABIN5518740) IHC analysis of Bax using anti-Bax antibody . Bax was detected in paraffin-embedded s...
Immunohistochemistry (IHC) image for anti-BCL2-Associated X Protein (BAX) (AA 17-48), (N-Term) antibody (ABIN5518740) IHC analysis of Bax using anti-Bax antibody . Bax was detected in paraffin-embedded s...
Immunohistochemistry (IHC) image for anti-BCL2-Associated X Protein (BAX) (AA 17-48), (N-Term) antibody (ABIN5518740) IHC analysis of Bax using anti-Bax antibody . Bax was detected in paraffin-embedded s...
Flow Cytometry (FACS) image for anti-BCL2-Associated X Protein (BAX) (AA 17-48), (N-Term) antibody (ABIN5518740) Flow Cytometry analysis of A549 cells using anti-Bax antibody . Overlay histogram sho...