anti-Human Exocyst Complex Component 3 antibody for Immunofluorescence

Recommended Exocyst Complex Component 3 Antibody (supplied by: Log in to see )

Exocyst Complex Component 3 (EXOC3) Antibodies
  • CG5341
  • Dmel\\CG5341
  • Dsec6
  • Sec6
  • Sec6p
  • dsec6
  • sec 6
  • F14O23.20
  • F14O23_20
  • sec6l1
  • fi26g09
  • wu:fi26g09
  • wu:fi34a09
  • wu:fj62h05
  • wu:fk66f08
  • zgc:55709
  • SEC6L1
  • SEC6
  • 2810050O03Rik
  • E430013E20Rik
  • Sec6l1
  • rSec6
  • Secretory 6
  • SEC6
  • exocyst complex component 3
  • Exocyst complex component 3
  • Sec6
  • SEC6
  • EXOC3
  • exoc3
  • Exoc3
  • sec-6
Immunocytochemistry (ICC), Immunofluorescence (IF), Western Blotting (WB)
Log in to see
Supplier Product No.
Log in to see

Get this product for free

Submit your validation data for this product and get a full refund. I want to validate this product

Learn more

Available images

Catalog No. ABIN4890535
Contact our Customer Service for availability and price in your country.
Relevance Score ABIN Application Conjugate Host Isotype Epitope Supplier Clonality References Details
11.747924 ABIN5079555 ICC IF WB Rabbit IgG Log in to see Polyclonal 0
1 ABIN4352417 ICC IF IHC IHC (p) WB Mouse IgG2a Log in to see 9H5 0
1 ABIN4352418 ICC IF IHC IHC (p) WB Mouse IgG2a Log in to see 9H5 0
1 ABIN4352416 ICC IF WB Rabbit Log in to see Polyclonal 0
1 ABIN5697650 ELISA IF IHC WB Rabbit IgG Log in to see Polyclonal 0


Antigen Exocyst Complex Component 3 (EXOC3) Antibodies
Reactivity Human
(34), (24), (24), (5), (5), (4), (4), (4), (3), (3), (3), (2), (2), (2), (1)
Host Rabbit
(27), (9)
Conjugate Un-conjugated
(1), (1), (1), (1), (1), (1), (1), (1), (1), (1), (1), (1), (1), (1)
Application Immunocytochemistry (ICC), Immunofluorescence (IF), Western Blotting (WB)
(24), (13), (8), (7), (6), (5), (4)
Supplier Log in to see

Product details

Target Details Application Details Handling Images
Purification Immunogen affinity purified
Immunogen Synthetic peptides corresponding to EXOC3(exocyst complex component 3) The peptide sequence was selected from the middle region of EXOC3. Peptide sequence LERTVTTRIEGTQADTRESDKMWLVRHLEIIRKYVLDDLIVAKNLMVQCF.

Target Details

Product details Application Details Handling Images back to top
Alternative Name SEC6 (EXOC3 Antibody Abstract)
Background Gene Symbol: EXOC3
Molecular Weight Theoretical MW: 85 kDa
Gene ID 11336
UniProt Q6P2E8
Pathways Peptide Hormone Metabolism, Synaptic Vesicle Exocytosis

Application Details

Product details Target Details Handling Images back to top
Application Notes Western Blot 1:100-1:2000, Immunocytochemistry/ImmunofluorescenceThis is a rabbit polyclonal antibody against EXOC3 and was validated on Western blot. The observed molecular weight of the protein may vary from the listed predicted molecular weight due to post translational modifications, post translation cleavages, relative charges, and other experimental factors.

The antibodies are intended for use in vitro experiments only. Our antibodies have not been tested nor are recommended for use in vivo.

Restrictions For Research Use only


Product details Target Details Application Details Images back to top
Format Liquid
Buffer PBS and 2 % Sucrose
Buffer contains: 0.09 % Sodium Azide
Preservative Sodium azide
Precaution of Use This product contains Sodium azide: a POISONOUS AND HAZARDOUS SUBSTANCE which should be handled by trained staff only.
Storage -20 °C
Storage Comment Store at -20°C. Avoid freeze-thaw cycles.


Product details Target Details Application Details Handling back to top
Supplier Images
Immunofluorescence (IF) image for anti-Exocyst Complex Component 3 (EXOC3) antibody (ABIN4890535) Immunocytochemistry/Immunofluorescence: SEC6 Antibody [NBP1-55109] - Formalin Fixed P...
Western Blotting (WB) image for anti-Exocyst Complex Component 3 (EXOC3) antibody (ABIN4890535) Western Blot: SEC6 Antibody [NBP1-55109] - Titration: 0.2-1 ug/ml, Positive Control: ...