anti-Mouse (Murine) MAPKAP1 antibody for Immunohistochemistry

Recommended MAPKAP1 Antibody (supplied by: Log in to see )

Antigen
Mitogen-Activated Protein Kinase Associated Protein 1 (MAPKAP1) Antibodies
  • CG10105
  • Dmel\\CG10105
  • dSin1
  • sin1
  • MAPKAP1
  • im:7143088
  • si:ch73-242f23.1
  • mip1
  • sin1b
  • sin1g
  • MGC53034
  • JC310
  • MIP1
  • SIN1
  • SIN1b
  • SIN1g
  • AI591529
  • D230039K05Rik
  • Sin1
  • SAPK-interacting protein 1
  • mitogen-activated protein kinase associated protein 1
  • mitogen-activated protein kinase associated protein 1 L homeolog
  • Sin1
  • MAPKAP1
  • mapkap1
  • Mapkap1
  • mapkap1.L
Reactivity
Human, Mouse (Murine), Rat (Rattus)
87
46
40
13
10
5
3
3
3
2
1
1
1
Host
Rabbit
89
Clonality
Polyclonal
Conjugate
This MAPKAP1 antibody is un-conjugated
2
2
2
2
2
2
Application
Immunocytochemistry (ICC), Immunofluorescence (IF), Immunohistochemistry (IHC), Immunohistochemistry (Paraffin-embedded Sections) (IHC (p)), Western Blotting (WB)
81
38
38
18
11
3
2
2
2
2
Supplier
Log in to see
Supplier Product No.
Log in to see
Request

Get this product for free

Submit your validation data for this product and get a full refund. I want to validate this product

Learn more

Available images

Catalog No. ABIN4353814
Contact our Customer Service for availability and price in your country.
Relevance Score ABIN Application Conjugate Host Isotype Epitope Supplier Clonality References Details
8.884575 ABIN960906 IHC IHC (p) WB Rabbit AA 100-150 Log in to see Polyclonal 0
8.884575 ABIN213952 IHC IHC (p) WB Rabbit IgG Internal Region Log in to see Polyclonal 0
8.884575 ABIN214511 IHC IHC (p) WB Rabbit IgG N-Term Log in to see Polyclonal 0
8.884575 ABIN6255748 IHC WB Rabbit IgG pThr86 Log in to see Polyclonal 0
8.884575 ABIN1031450 IHC ELISA WB Rabbit N-Term Log in to see Polyclonal 0
8.884575 ABIN1030995 IHC ELISA WB Rabbit Middle Region Log in to see Polyclonal 0
1 ABIN258134 ICC IF IHC IHC (p) IP PLA WB Rabbit IgG C-Term Log in to see Polyclonal 5
1 ABIN1002804 IHC ELISA WB Rabbit IgG N-Term Log in to see Polyclonal 4
1 ABIN1002803 IHC ELISA WB Rabbit IgG Internal Region Log in to see Polyclonal 4
1 ABIN4353812 ELISA IHC IHC (p) WB Rabbit Center Log in to see Polyclonal 0
1 ABIN4353811 ELISA ICC IF IHC IHC (p) WB Rabbit N-Term Log in to see Polyclonal 0
1 ABIN6265084 ELISA IHC WB Rabbit IgG Log in to see Polyclonal 0
1 ABIN609038 IHC IHC (p) WB Rabbit IgG Internal Region Log in to see Polyclonal 0
1 ABIN1819368 IHC IHC (p) WB Rabbit IgG Log in to see Polyclonal 0
1 ABIN1912044 IF IHC IHC (p) IP PLA WB Rabbit IgG AA 470-522, C-Term Log in to see Polyclonal 0
1 ABIN1912046 IF IHC IHC (p) Rabbit IgG C-Term Log in to see Polyclonal 0
1 ABIN5701108 ELISA IHC WB Rabbit IgG Log in to see Polyclonal 0
1 ABIN5701107 ELISA IF IHC WB Rabbit IgG Log in to see Polyclonal 0
1 ABIN2938571 ELISA IF/ICC IHC WB Rabbit IgG Log in to see Polyclonal 0
1 ABIN2472006 IHC WB Rabbit AA 100-150 Log in to see Polyclonal 0

General

Antigen Mitogen-Activated Protein Kinase Associated Protein 1 (MAPKAP1) Antibodies
Reactivity Human, Mouse (Murine), Rat (Rattus)
(87), (46), (40), (13), (10), (5), (3), (3), (3), (2), (1), (1), (1)
Host Rabbit
(89)
Clonality
Polyclonal
Conjugate This MAPKAP1 antibody is un-conjugated
(2), (2), (2), (2), (2), (2)
Application Immunocytochemistry (ICC), Immunofluorescence (IF), Immunohistochemistry (IHC), Immunohistochemistry (Paraffin-embedded Sections) (IHC (p)), Western Blotting (WB)
(81), (38), (38), (18), (11), (3), (2), (2), (2), (2)
Supplier Log in to see

Product Details anti-MAPKAP1 Antibody

Target Details MAPKAP1 Application Details Handling Images
Specificity Specificity of antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins.
Purification Immunogen affinity purified
Immunogen This antibody was developed against Recombinant Protein corresponding to amino acids:NPFNEYSKFDGKGHVGTTATKKIDVYLPLHSSQDRLLPMTVVTMASARVQDLIGLICWQYTSEGREPKLNDNVSAYCLHIAEDDGEVDTDFPPLDSNEPIHKFGFSTLALVEKYSSPGLTSKESLFVRINAAHGFSLIQVDNTKVTMKE
Isotype IgG
Plasmids, Primers & others

Target Details MAPKAP1

Product Details anti-MAPKAP1 Antibody Application Details Handling Images back to top
Antigen
Alternative Name Sin1/MAPKAP1 (MAPKAP1 Antibody Abstract)
Background Gene Symbol: MAPKAP1
Gene ID 79109
Pathways PI3K-Akt Signaling, Fc-epsilon Receptor Signaling Pathway, Neurotrophin Signaling Pathway, Skeletal Muscle Fiber Development, CXCR4-mediated Signaling Events

Application Details

Product Details anti-MAPKAP1 Antibody Target Details MAPKAP1 Handling Images back to top
Application Notes Western Blot 1:100-1:500, Immunohistochemistry, Immunocytochemistry/Immunofluorescence 1 - 4 μg/mL, Immunohistochemistry-Paraffin 1:20 - 1:50For IHC-Paraffin HIER pH 6 retrieval is recommended.
Comment

The antibodies are intended for use in vitro experiments only. Our antibodies have not been tested nor are recommended for use in vivo.

Restrictions For Research Use only

Handling

Product Details anti-MAPKAP1 Antibody Target Details MAPKAP1 Application Details Images back to top
Format Liquid
Buffer PBS ( pH 7.2) and 40 % Glycerol
Buffer contains: 0.02 % Sodium Azide
Preservative Sodium azide
Precaution of Use This product contains Sodium azide: a POISONOUS AND HAZARDOUS SUBSTANCE which should be handled by trained staff only.
Storage 4 °C,-20 °C
Storage Comment Store at 4°C short term. Aliquot and store at -20°C long term. Avoid freeze-thaw cycles.

Images

Product Details anti-MAPKAP1 Antibody Target Details MAPKAP1 Application Details Handling back to top
Supplier Images
Immunohistochemistry (IHC) image for anti-Mitogen-Activated Protein Kinase Associated Protein 1 (MAPKAP1) antibody (ABIN4353814) Immunohistochemistry: Sin1/MAPKAP1 Antibody [NBP1-89569] - Staining of human tonsil s...
Western Blotting (WB) image for anti-Mitogen-Activated Protein Kinase Associated Protein 1 (MAPKAP1) antibody (ABIN4353814) Western Blot: Sin1/MAPKAP1 Antibody [NBP1-89569] - Lane 1: NIH-3T3 cell lysate (Mouse...
Immunofluorescence (IF) image for anti-Mitogen-Activated Protein Kinase Associated Protein 1 (MAPKAP1) antibody (ABIN4353814) Immunocytochemistry/Immunofluorescence: Sin1/MAPKAP1 Antibody [NBP1-89569] - Staining...
Immunofluorescence (Paraffin-embedded Sections) (IF (p)) image for anti-Mitogen-Activated Protein Kinase Associated Protein 1 (MAPKAP1) antibody (ABIN4353814) Immunohistochemistry-Paraffin: Sin1/MAPKAP1 Antibody - Staining of human tonsil show...
Immunohistochemistry (Paraffin-embedded Sections) (IHC (p)) image for anti-Mitogen-Activated Protein Kinase Associated Protein 1 (MAPKAP1) antibody (ABIN4353814) Immunohistochemistry-Paraffin: Sin1/MAPKAP1 Antibody - Staining of human pancreas sh...
Immunohistochemistry (Paraffin-embedded Sections) (IHC (p)) image for anti-Mitogen-Activated Protein Kinase Associated Protein 1 (MAPKAP1) antibody (ABIN4353814) Immunohistochemistry-Paraffin: Sin1/MAPKAP1 Antibody - Staining in human testis and ...
Immunohistochemistry (Paraffin-embedded Sections) (IHC (p)) image for anti-Mitogen-Activated Protein Kinase Associated Protein 1 (MAPKAP1) antibody (ABIN4353814) Immunohistochemistry-Paraffin: Sin1/MAPKAP1 Antibody - Staining of human testis show...