anti-Human NSMCE1 antibody for Immunocytochemistry

Recommended NSMCE1 Antibody (supplied by: Log in to see )

Non-SMC Element 1 Homolog (S. Cerevisiae) (NSMCE1) Antibodies
  • zgc:92777
  • NSMCE1
  • NSE1
  • 2510027N19Rik
  • RGD1307760
  • NSE1 homolog, SMC5-SMC6 complex component
  • NSE1 homolog, SMC5-SMC6 complex component L homeolog
  • nsmce1
  • NSMCE1
  • nsmce1.L
  • Nsmce1
This NSMCE1 antibody is un-conjugated
Immunocytochemistry (ICC), Immunofluorescence (IF), Immunohistochemistry (IHC), Immunohistochemistry (Paraffin-embedded Sections) (IHC (p))
Log in to see
Supplier Product No.
Log in to see

Available images

Catalog No. ABIN4340767
Contact our Customer Service for availability and price in your country.
Relevance Score ABIN Application Conjugate Host Isotype Epitope Supplier Clonality References Details
-3.8413315 ABIN4340768 ICC IF IHC IHC (p) WB Rabbit IgG Log in to see Polyclonal 0


Antigen Non-SMC Element 1 Homolog (S. Cerevisiae) (NSMCE1) Antibodies
Reactivity Human
(32), (5), (5), (3), (3), (2), (2), (2), (2), (2), (1)
Host Rabbit
(31), (1)
Conjugate This NSMCE1 antibody is un-conjugated
(2), (2), (2), (2), (2), (2)
Application Immunocytochemistry (ICC), Immunofluorescence (IF), Immunohistochemistry (IHC), Immunohistochemistry (Paraffin-embedded Sections) (IHC (p))
(32), (15), (5), (4), (2), (1), (1)
Supplier Log in to see

Product Details anti-NSMCE1 Antibody

Target Details NSMCE1 Application Details Handling Images
Specificity Specificity of antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins.
Purification Immunogen affinity purified
Immunogen This antibody was developed against Recombinant Protein corresponding to amino acids:RRMGVMTDVHRRFLQLLMTHGVLEEWDVKRLQTHCYKVHDRNATVDKLEDFINNINSVLESLYIEIKRGVTEDDGRPIYALVN
Isotype IgG
Plasmids, Primers & others

Target Details NSMCE1

Product Details anti-NSMCE1 Antibody Application Details Handling Images back to top
Alternative Name NSMCE1 (NSMCE1 Antibody Abstract)
Background Gene Symbol: NSMCE1
Gene ID 197370
Pathways Positive Regulation of Response to DNA Damage Stimulus

Application Details

Product Details anti-NSMCE1 Antibody Target Details NSMCE1 Handling Images back to top
Application Notes Immunohistochemistry, Immunocytochemistry/Immunofluorescence 1 - 4 μg/mL, Immunohistochemistry-Paraffin 1:200 - 1:500

The antibodies are intended for use in vitro experiments only. Our antibodies have not been tested nor are recommended for use in vivo.

Restrictions For Research Use only


Product Details anti-NSMCE1 Antibody Target Details NSMCE1 Application Details Images back to top
Format Liquid
Buffer PBS ( pH 7.2) and 40 % Glycerol
Buffer contains: 0.02 % Sodium Azide
Preservative Sodium azide
Precaution of Use This product contains Sodium azide: a POISONOUS AND HAZARDOUS SUBSTANCE which should be handled by trained staff only.
Storage 4 °C,-20 °C
Storage Comment Store at 4°C short term. Aliquot and store at -20°C long term. Avoid freeze-thaw cycles.


Product Details anti-NSMCE1 Antibody Target Details NSMCE1 Application Details Handling back to top
Supplier Images
Immunofluorescence (IF) image for anti-Non-SMC Element 1 Homolog (S. Cerevisiae) (NSMCE1) antibody (ABIN4340767) Immunocytochemistry/Immunofluorescence: NSMCE1 Antibody [NBP1-92200] - Staining of hu...
Immunohistochemistry (Paraffin-embedded Sections) (IHC (p)) image for anti-Non-SMC Element 1 Homolog (S. Cerevisiae) (NSMCE1) antibody (ABIN4340767) Immunohistochemistry-Paraffin: NSMCE1 Antibody [NBP1-92200] - Staining of human kidne...
Immunohistochemistry (Paraffin-embedded Sections) (IHC (p)) image for anti-Non-SMC Element 1 Homolog (S. Cerevisiae) (NSMCE1) antibody (ABIN4340767) Immunohistochemistry-Paraffin: NSMCE1 Antibody - Staining of human kidney shows stro...
Immunohistochemistry (Paraffin-embedded Sections) (IHC (p)) image for anti-Non-SMC Element 1 Homolog (S. Cerevisiae) (NSMCE1) antibody (ABIN4340767) Immunohistochemistry-Paraffin: NSMCE1 Antibody - Staining of human pancreas shows lo...
Immunohistochemistry (Paraffin-embedded Sections) (IHC (p)) image for anti-Non-SMC Element 1 Homolog (S. Cerevisiae) (NSMCE1) antibody (ABIN4340767) Immunohistochemistry-Paraffin: NSMCE1 Antibody - Staining in human parathyroid gland...