anti-Rat (Rattus) NSMCE1 antibody for Western Blotting

Recommended NSMCE1 Antibody (supplied by: Log in to see )

Antigen
Non-SMC Element 1 Homolog (S. Cerevisiae) (NSMCE1) Antibodies
  • zgc:92777
  • NSMCE1
  • NSE1
  • 2510027N19Rik
  • RGD1307760
  • NSE1 homolog, SMC5-SMC6 complex component
  • NSE1 homolog, SMC5-SMC6 complex component L homeolog
  • nsmce1
  • NSMCE1
  • nsmce1.L
  • Nsmce1
Reactivity
Human, Mouse (Murine), Rat (Rattus)
30
5
5
4
3
3
3
2
2
2
2
Host
Rabbit
29
1
Clonality
Polyclonal
Conjugate
This NSMCE1 antibody is un-conjugated
2
2
2
2
2
2
Application
Western Blotting (WB)
30
15
3
2
1
1
Options
Supplier
Log in to see
Supplier Product No.
Log in to see

Available images

Catalog No. ABIN630218
$ 388.93
Plus shipping costs $45.00
Relevance Score ABIN Application Conjugate Host Isotype Epitope Supplier Clonality References Details
4.8439007 ABIN2781252 WB Rabbit Middle Region Log in to see Polyclonal 0
4.8439007 ABIN2781253 WB Rabbit N-Term Log in to see Polyclonal 1
4.8439007 ABIN2462690 ELISA WB Rabbit Log in to see Polyclonal 0
4 ABIN203534 WB Rabbit IgG AA 81-130 Log in to see Polyclonal 0
4 ABIN6744745 WB Rabbit AA 143-192 Log in to see Polyclonal 0

General

Antigen Non-SMC Element 1 Homolog (S. Cerevisiae) (NSMCE1) Antibodies
Reactivity Human, Mouse (Murine), Rat (Rattus)
(30), (5), (5), (4), (3), (3), (3), (2), (2), (2), (2)
Host Rabbit
(29), (1)
Clonality
Polyclonal
Conjugate This NSMCE1 antibody is un-conjugated
(2), (2), (2), (2), (2), (2)
Application Western Blotting (WB)
(30), (15), (3), (2), (1), (1)
Supplier Log in to see

Product Details anti-NSMCE1 Antibody

Target Details NSMCE1 Application Details Handling Images
Purification Purified
Immunogen NSMCE1 antibody was raised using a synthetic peptide corresponding to a region with amino acids RPIYALVNLATTSISKMATDFAENELDLFRKALELIIDSETGFASSTNIL
Plasmids, Primers & others

Target Details NSMCE1

Product Details anti-NSMCE1 Antibody Application Details Handling Images back to top
Antigen
Alternative Name NSMCE1 (NSMCE1 Antibody Abstract)
Background NSMCE1 is a probable component of the SMC5-SMC6 complex, a complex involved in DNA double-strand breaks by homologous recombination. The complex may promote sister chromatid homologous recombination by recruiting the SMC1-SMC3 cohesin complex to double-strand breaks.
Molecular Weight 28 kDa (MW of target protein)
Pathways Positive Regulation of Response to DNA Damage Stimulus

Application Details

Product Details anti-NSMCE1 Antibody Target Details NSMCE1 Handling Images back to top
Application Notes WB: 2.5 µg/mL
Optimal conditions should be determined by the investigator.
Comment

NSMCE1 Blocking Peptide, catalog no. 33R-8094, is also available for use as a blocking control in assays to test for specificity of this NSMCE1 antibody

Restrictions For Research Use only

Handling

Product Details anti-NSMCE1 Antibody Target Details NSMCE1 Application Details Images back to top
Format Lyophilized
Reconstitution Lyophilized powder. Add distilled water for a 1 mg/mL concentration of NSMCE1 antibody in PBS
Concentration Lot specific
Buffer PBS
Handling Advice Avoid repeated freeze/thaw cycles.
Storage 4 °C
Storage Comment Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Images

Product Details anti-NSMCE1 Antibody Target Details NSMCE1 Application Details Handling back to top
Supplier Images
Western Blotting (WB) image for anti-Non-SMC Element 1 Homolog (S. Cerevisiae) (NSMCE1) antibody (ABIN630218) NSMCE1 antibody used at 2.5 ug/ml to detect target protein.