VAPB Protein (AA 1-222) (His tag)
-
- Target See all VAPB Proteins
- VAPB (VAMP (Vesicle-Associated Membrane Protein)-Associated Protein B and C (VAPB))
- Protein Type
- Recombinant
- Protein Characteristics
- AA 1-222
-
Origin
- Human
-
Source
- Escherichia coli (E. coli)
- Purification tag / Conjugate
- This VAPB protein is labelled with His tag.
- Application
- SDS-PAGE (SDS)
- Sequence
- MGSSHHHHHHSSGLVPRGSHMAKVEQVLSLEPQHELKFRG PFTDVVTTNLKLGNPTDRNVCFKVKTTAPRRYCVRPNSGI IDAGASINVSVMLQPFDYDPNEKSKHKFMVQSMFAPTDTS DMEAVWKEAKPEDLMDSKLRCVFELPAENDKPHDVEINKI ISTTASKTETPIVSKSLSSSLDDTEVKKVMEECKRLQGEV QRLREENKQFKEEDGLRMRKTVQSNSPISALAPTGKEEGL ST
- Characteristics
- VAPB, 1-222aa, Human, His tag, E.coli
- Purity
- > 90 % by SDS - PAGE
-
-
- Restrictions
- For Research Use only
-
- Format
- Liquid
- Concentration
- 1.0 mg/ml (determined by Bradford assay)
- Buffer
- Liquid. 20mM Tris-HCl buffer (pH8.0) containing 10% glycerol
- Storage
- 4 °C
-
- Target
- VAPB (VAMP (Vesicle-Associated Membrane Protein)-Associated Protein B and C (VAPB))
- Alternative Name
- VAPB (VAPB Products)
- Synonyms
- ALS8 Protein, VAMP-B Protein, VAP-B Protein, AI225786 Protein, AI840687 Protein, AI848259 Protein, D2Abb2e Protein, R75548 Protein, VAP33b Protein, Vamp33b Protein, fc05d09 Protein, wu:fa96d05 Protein, wu:fc05d09 Protein, zgc:66045 Protein, vamp-b Protein, vamp-c Protein, vap-b Protein, vap-c Protein, vapb Protein, VAMP associated protein B and C Protein, vesicle-associated membrane protein-associated protein B/C Protein, vesicle-associated membrane protein, associated protein B and C Protein, VAMP (vesicle-associated membrane protein)-associated protein B and C Protein, VAMP (vesicle-associated membrane protein)-associated protein B and C L homeolog Protein, VAPB Protein, Tsp_07972 Protein, Vapb Protein, vapb Protein, vapb.L Protein
- Background
- VAPB, also known as vesicle-associated membrane protein (VAMP)-associated protein B, is a type IV transmembrane protein and member of the VAP family of proteins. This protein may play a role in vesicle trafficking. It is found in plasma and intracellular vesicle membranes as a homodimer and heterodimer with VAPA, and interacts with VAMP1 and VAMP2. Defects in VAPB are a cause of amyotrophic lateral sclerosis type 8 and spinal muscular atrophy autosomal dominant Finkel type. Recombinant human VAPB protein, fused to His-tag at N-terminus, was expressed in E.coli and purified by using conventional chromatography. Synonyms: Vesicle-associated membrane protein-associated protein B/C, ALS8, VAMP-B, VAMP-C, VAP-B, VAP-C. NCBI no.: NP_004729
- Molecular Weight
- 27.1 kDa (242aa) confirmed by MALDI-TOF (molecular weight on SDS-PAGE will appear higher)
- Pathways
- ER-Nucleus Signaling
-