anti-Human Mitochondrially Encoded Cytochrome B antibody for Western Blotting

Recommended Mitochondrially Encoded Cytochrome B Antibody (supplied by: Log in to see )

Antigen
Mitochondrially Encoded Cytochrome B (MT-CYB) Antibodies
  • cytB
  • cytb
  • MTCYB
  • cytochrome b
  • CYTB
Epitope
N-Term
11
9
8
7
3
2
1
1
1
Reactivity
Human
41
13
6
1
Host
Rabbit
43
1
Clonality
Polyclonal
Conjugate
Un-conjugated
2
2
2
2
2
2
Application
Western Blotting (WB)
37
27
9
2
2
1
1
1
1
Options
Supplier
Log in to see
Supplier Product No.
Log in to see
Request

Get this product for free

Submit your validation data for this product and get a full refund. I want to validate this product

Learn more

Available images

Catalog No. ABIN635601
$ 473.93
Plus shipping costs $45.00
Relevance Score ABIN Application Conjugate Host Isotype Epitope Supplier Clonality References Details
12.754771 ABIN4901354 ELISA WB Rabbit IgG AA 331-380 Log in to see Polyclonal 0
10.802582 ABIN2773962 WB Rabbit N-Term Log in to see Polyclonal 0
10.802582 ABIN6259564 ELISA IHC WB Rabbit IgG Log in to see Polyclonal 0
10 ABIN1494783 IHC IHC (p) WB Rabbit IgG N-Term Log in to see Polyclonal 0
7.802582 ABIN5517887 WB Rabbit C-Term Log in to see Polyclonal 0
7.802582 ABIN5996506 WB Rabbit IgG Log in to see Polyclonal 0
4.802582 ABIN653573 WB Rabbit Ig Fraction AA 201-228, Center Log in to see Polyclonal 0
4.802582 ABIN951796 EIA WB Rabbit Ig Fraction AA 207-237, Middle Region Log in to see Polyclonal 0
4.802582 ABIN2459384 ELISA WB Rabbit Log in to see Polyclonal 0
4.802582 ABIN5940912 WB Rabbit Log in to see Polyclonal 0
4 ABIN5538891 WB Rabbit Ig Fraction AA 201-228 Log in to see Polyclonal 0
1 ABIN1964858 ELISA WB APC Rabbit IgG AA 201-228 Log in to see Polyclonal 0
1 ABIN1973809 ELISA WB HRP Rabbit IgG AA 201-228 Log in to see Polyclonal 0
1 ABIN1975871 ELISA WB PE Rabbit IgG AA 201-228 Log in to see Polyclonal 0
1 ABIN1962481 ELISA WB Alkaline Phosphatase (AP) Rabbit IgG AA 201-228 Log in to see Polyclonal 0
1 ABIN1971273 ELISA WB FITC Rabbit IgG AA 201-228 Log in to see Polyclonal 0
1 ABIN1968961 ELISA WB Biotin Rabbit IgG AA 201-228 Log in to see Polyclonal 0
1 ABIN1813459 WB Rabbit AA 201-228 Log in to see Polyclonal 0
1 ABIN1837141 WB Rabbit AA 244-293 Log in to see Polyclonal 0
1 ABIN2597734 ELISA WB Rabbit IgG AA 201-228 Log in to see Polyclonal 0

General

Antigen Mitochondrially Encoded Cytochrome B (MT-CYB) Antibodies
Epitope N-Term
(11), (9), (8), (7), (3), (2), (1), (1), (1)
Reactivity Human
(41), (13), (6), (1)
Host Rabbit
(43), (1)
Clonality
Polyclonal
Conjugate Un-conjugated
(2), (2), (2), (2), (2), (2)
Application Western Blotting (WB)
(37), (27), (9), (2), (2), (1), (1), (1), (1)
Supplier Log in to see

Product details

Target Details Application Details Handling Images
Specificity CYTB antibody was raised against the N terminal of CYTB
Purification Affinity purified
Immunogen CYTB antibody was raised using the N terminal of CYTB corresponding to a region with amino acids TPMRKINPLMKLINHSFIDLPTPSNISAWWNFGSLLGACLILQITTGLFL

Target Details

Product details Application Details Handling Images back to top
Antigen
Alternative Name CYTB (MT-CYB Antibody Abstract)
Background CYTB belongs to the cytochrome b family. It is a component of the ubiquinol-cytochrome c reductase complex (complex III or cytochrome b-c1 complex), which is a respiratory chain that generates an electrochemical potential coupled to ATP synthesis.
Molecular Weight 42 kDa (MW of target protein)
Pathways Proton Transport

Application Details

Product details Target Details Handling Images back to top
Application Notes WB: 1 µg/mL
Optimal conditions should be determined by the investigator.
Comment

CYTB Blocking Peptide, catalog no. 33R-9225, is also available for use as a blocking control in assays to test for specificity of this CYTB antibody

Restrictions For Research Use only

Handling

Product details Target Details Application Details Images back to top
Format Lyophilized
Reconstitution Lyophilized powder. Add distilled water for a 1 mg/mL concentration of CYTB antibody in PBS
Concentration Lot specific
Buffer PBS
Handling Advice Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.
Storage 4 °C
Storage Comment Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Images

Product details Target Details Application Details Handling back to top
Supplier Images
Western Blotting (WB) image for anti-Mitochondrially Encoded Cytochrome B (MT-CYB) (N-Term) antibody (ABIN635601) CYTB antibody used at 1 ug/ml to detect target protein.