anti-Rat (Rattus) WWTR1 antibody for Western Blotting

Recommended WWTR1 Antibody (supplied by: Log in to see )

Antigen
WW Domain Containing Transcription Regulator 1 (WWTR1) Antibodies
  • WWTR1
  • TAZ
  • 2310058J06Rik
  • 2610021I22Rik
  • C78399
  • Taz
  • WW domain containing transcription regulator 1 L homeolog
  • WW domain containing transcription regulator 1
  • wwtr1.L
  • wwtr1
  • WWTR1
  • Wwtr1
Reactivity
Human, Mouse (Murine), Rat (Rattus)
63
19
11
4
3
1
1
1
Host
Rabbit
43
20
Clonality
Polyclonal
Conjugate
This WWTR1 antibody is un-conjugated
2
2
2
2
1
1
Application
Immunocytochemistry (ICC), Immunofluorescence (IF), Immunohistochemistry (IHC), Immunohistochemistry (Paraffin-embedded Sections) (IHC (p)), Simple Western (SimWes), Western Blotting (WB)
63
21
13
11
7
7
5
2
1
1
1
1
Supplier
Log in to see
Supplier Product No.
Log in to see
Request

Get this product for free

Submit your validation data for this product and get a full refund. I want to validate this product

Learn more

Available images

Catalog No. ABIN4357944
Contact our Customer Service for availability and price in your country.
Relevance Score ABIN Application Conjugate Host Isotype Epitope Supplier Clonality References Details
3.0788064 ABIN2779708 WB Rabbit N-Term Log in to see Polyclonal 1
3.0788064 ABIN258561 ChIP ICC IF IHC (p) IP SimWes WB Rabbit Log in to see Polyclonal 6
3.0788064 ABIN2737822 WB Rabbit IgG Log in to see Polyclonal 0
3.0788064 ABIN2457959 ELISA WB Rabbit Log in to see Polyclonal 0
3.0788064 ABIN3197847 IHC WB Rabbit Log in to see Polyclonal 0
3.0788064 ABIN6006274 IHC WB Rabbit IgG full length Log in to see Polyclonal 0
3.0788064 ABIN3047029 IHC WB Rabbit IgG Log in to see Polyclonal 0
3.0788064 ABIN5545513 WB Rabbit IgG Log in to see Polyclonal 0
1 ABIN5674325 WB Rabbit AA 386-390 Log in to see Polyclonal 0
1 ABIN5906411 ELISA WB Rabbit IgG AA 386-390 Log in to see Polyclonal 0
1 ABIN5966060 IHC WB Rabbit IgG Log in to see Polyclonal 0

General

Antigen WW Domain Containing Transcription Regulator 1 (WWTR1) Antibodies
Reactivity Human, Mouse (Murine), Rat (Rattus)
(63), (19), (11), (4), (3), (1), (1), (1)
Host Rabbit
(43), (20)
Clonality
Polyclonal
Conjugate This WWTR1 antibody is un-conjugated
(2), (2), (2), (2), (1), (1)
Application Immunocytochemistry (ICC), Immunofluorescence (IF), Immunohistochemistry (IHC), Immunohistochemistry (Paraffin-embedded Sections) (IHC (p)), Simple Western (SimWes), Western Blotting (WB)
(63), (21), (13), (11), (7), (7), (5), (2), (1), (1), (1), (1)
Pubmed 3 references available
Supplier Log in to see

Product Details anti-WWTR1 Antibody

Target Details WWTR1 Application Details Handling References for anti-WWTR1 antibody (ABIN4357944) Images
Specificity Specificity of antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins.
Purification Immunogen affinity purified
Immunogen This antibody was developed against Recombinant Protein corresponding to amino acids:MNPKPSSWRKKILPESFFKEPDSGSHSRQSSTDSSGGHPGPRLAGGAQHVRSHSSPASLQLGTGAGAAGSPAQQHAHLRQQSYDVTDELPLPPGWEMTFTATGQRYFLNHIEKITTWQDPRKAMNQPLNHMNLHPAVSST
Isotype IgG
Plasmids, Primers & others

Target Details WWTR1

Product Details anti-WWTR1 Antibody Application Details Handling References for anti-WWTR1 antibody (ABIN4357944) Images back to top
Antigen
Alternative Name TAZ/WWTR1 (WWTR1 Antibody Abstract)
Background Gene Symbol: WWTR1
Gene ID 25937
UniProt Q9GZV5
Pathways Regulation of Lipid Metabolism by PPARalpha

Application Details

Product Details anti-WWTR1 Antibody Target Details WWTR1 Handling References for anti-WWTR1 antibody (ABIN4357944) Images back to top
Application Notes Western Blot 1:100-1:500, Simple Western 1:30, Immunohistochemistry 1:10-1:500, Immunocytochemistry/Immunofluorescence 1 - 4 μg/mL, Immunohistochemistry-Paraffin 1:50-1:200Immunohistochemistry retrieval recommended: HIER pH 6, Immunocytochemistry/Immunofluorescence Fixation Permeabilization: PFA/Triton X-100. In Simple Western only 10 - 15 μL of the recommended dilution is used per data point. Separated by Size-Wes, Sally Sue/Peggy Sue.
Comment

The antibodies are intended for use in vitro experiments only. Our antibodies have not been tested nor are recommended for use in vivo.

Restrictions For Research Use only

Handling

Product Details anti-WWTR1 Antibody Target Details WWTR1 Application Details References for anti-WWTR1 antibody (ABIN4357944) Images back to top
Format Liquid
Buffer PBS ( pH 7.2) and 40 % Glycerol
Buffer contains: 0.02 % Sodium Azide
Preservative Sodium azide
Precaution of Use This product contains Sodium azide: a POISONOUS AND HAZARDOUS SUBSTANCE which should be handled by trained staff only.
Storage 4 °C,-20 °C
Storage Comment Store at 4°C short term. Aliquot and store at -20°C long term. Avoid freeze-thaw cycles.

References for anti-WWTR1 antibody (ABIN4357944)

Product Details anti-WWTR1 Antibody Target Details WWTR1 Application Details Handling Images back to top
Product cited in:

Slemmons, Crose, Rudzinski, Bentley, Linardic: "Role of the YAP Oncoprotein in Priming Ras-Driven Rhabdomyosarcoma." in: PLoS ONE, Vol. 10, Issue 10, pp. e0140781, 2015 (Sample species: Mouse (Murine)). Further details: Immunohistochemistry

Sorrentino, Ruggeri, Specchia, Cordenonsi, Mano, Dupont, Manfrin, Ingallina, Sommaggio, Piazza, Rosato, Piccolo, Del Sal: "Metabolic control of YAP and TAZ by the mevalonate pathway." in: Nature cell biology, Vol. 16, Issue 4, pp. 357-66, 2014

Bhat, Salazar, Balasubramaniyan, Wani, Heathcock, Hollingsworth, James, Gumin, Diefes, Kim, Turski, Azodi, Yang, Doucette, Colman, Sulman, Lang, Rao, Copray, Vaillant, Aldape: "The transcriptional coactivator TAZ regulates mesenchymal differentiation in malignant glioma." in: Genes & development, Vol. 25, Issue 24, pp. 2594-609, 2011 (Sample species: Human). Further details: Immunohistochemistry

Images

Product Details anti-WWTR1 Antibody Target Details WWTR1 Application Details Handling References for anti-WWTR1 antibody (ABIN4357944) back to top
Supplier Images
Immunohistochemistry (Paraffin-embedded Sections) (IHC (p)) image for anti-WW Domain Containing Transcription Regulator 1 (WWTR1) antibody (ABIN4357944) Immunohistochemistry-Paraffin: TAZ/WWTR1 Antibody - Immunohistochemical staining of ...
Western Blotting (WB) image for anti-WW Domain Containing Transcription Regulator 1 (WWTR1) antibody (ABIN4357944) Western Blot: TAZ/WWTR1 Antibody - Analysis in mouse cell line NIH-3T3 and rat cell ...
Immunohistochemistry (Paraffin-embedded Sections) (IHC (p)) image for anti-WW Domain Containing Transcription Regulator 1 (WWTR1) antibody (ABIN4357944) Immunohistochemistry-Paraffin: TAZ/WWTR1 Antibody - Immunohistochemical staining of ...
Immunohistochemistry (Paraffin-embedded Sections) (IHC (p)) image for anti-WW Domain Containing Transcription Regulator 1 (WWTR1) antibody (ABIN4357944) Immunohistochemistry-Paraffin: TAZ/WWTR1 Antibody - Immunohistochemical staining of ...
Immunohistochemistry (Paraffin-embedded Sections) (IHC (p)) image for anti-WW Domain Containing Transcription Regulator 1 (WWTR1) antibody (ABIN4357944) Immunohistochemistry-Paraffin: TAZ/WWTR1 Antibody - Immunohistochemical staining of ...
Western Blotting (WB) image for anti-WW Domain Containing Transcription Regulator 1 (WWTR1) antibody (ABIN4357944) Western Blot: TAZ/WWTR1 Antibody - Analysis in human kidney tissue.
Immunofluorescence (IF) image for anti-WW Domain Containing Transcription Regulator 1 (WWTR1) antibody (ABIN4357944) Immunocytochemistry/Immunofluorescence: TAZ/WWTR1 Antibody - Staining of human cell ...
Immunohistochemistry (Paraffin-embedded Sections) (IHC (p)) image for anti-WW Domain Containing Transcription Regulator 1 (WWTR1) antibody (ABIN4357944) Immunohistochemistry-Paraffin: TAZ/WWTR1 Antibody - Staining of human skeletal muscl...
Immunohistochemistry (Paraffin-embedded Sections) (IHC (p)) image for anti-WW Domain Containing Transcription Regulator 1 (WWTR1) antibody (ABIN4357944) Immunohistochemistry-Paraffin: TAZ/WWTR1 Antibody - Staining in human placenta and s...