anti-Human MOCOS antibody for Immunohistochemistry

Recommended MOCOS Antibody (supplied by: Log in to see )

Antigen
Molybdenum Cofactor Sulfurase (MOCOS) Antibodies
  • HMCS
  • MCS
  • MOS
  • 1110018O12Rik
  • ABA DEFICIENT 3
  • ACI2
  • ALTERED CHLOROPLAST IMPORT 2
  • ATABA3
  • F19K19.13
  • F19K19_13
  • LOS5
  • LOW OSMOTIC STRESS 5
  • MOLYBDENUM COFACTOR SULFURASE
  • SIR3
  • SIRTINOL RESISTANT 3
  • DDBDRAFT_0217046
  • DDBDRAFT_0252757
  • DDB_0217046
  • DDB_0252757
  • Og
  • im:7142948
  • mocos
  • molybdenum cofactor sulfurase
  • molybdenum cofactor sulfurase (LOS5) (ABA3)
  • MOCOS
  • Mocos
  • ABA3
  • AOR_1_1090144
  • mocos
  • MCYG_05594
  • VDBG_04857
  • MGYG_02684
  • TERG_06775
  • mal
Reactivity
Human, Mouse (Murine)
9
4
3
Host
Rabbit
8
1
Clonality
Polyclonal
Application
Immunocytochemistry (ICC), Immunofluorescence (IF), Immunohistochemistry (IHC), Immunohistochemistry (Paraffin-embedded Sections) (IHC (p)), Simple Western (SimWes), Western Blotting (WB)
8
5
4
2
1
1
1
Supplier
Log in to see
Supplier Product No.
Log in to see
Request

Get this product for free

Submit your validation data for this product and get a full refund. I want to validate this product

Learn more

Available images

Catalog No. ABIN4335161
Contact our Customer Service for availability and price in your country.
Relevance Score ABIN Application Conjugate Host Isotype Epitope Supplier Clonality References Details
1 ABIN4335159 IHC IHC (p) WB Rabbit IgG Log in to see Polyclonal 0
1 ABIN4335160 ICC IF IHC IHC (p) SimWes WB Rabbit IgG Log in to see Polyclonal 0
1 ABIN1088899 IHC ELISA WB Rabbit IgG Log in to see Polyclonal 0
1 ABIN1088900 IHC ELISA WB Rabbit IgG Log in to see Polyclonal 0
1 ABIN2146776 IHC ELISA WB Rabbit IgG Log in to see Polyclonal 0

General

Antigen Molybdenum Cofactor Sulfurase (MOCOS) Antibodies
Reactivity Human, Mouse (Murine)
(9), (4), (3)
Host Rabbit
(8), (1)
Clonality
Polyclonal
Application Immunocytochemistry (ICC), Immunofluorescence (IF), Immunohistochemistry (IHC), Immunohistochemistry (Paraffin-embedded Sections) (IHC (p)), Simple Western (SimWes), Western Blotting (WB)
(8), (5), (4), (2), (1), (1), (1)
Pubmed 1 reference available
Supplier Log in to see

Product Details anti-MOCOS Antibody

Target Details MOCOS Application Details Handling References for anti-MOCOS antibody (ABIN4335161) Images
Specificity Specificity of antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins.
Purification Immunogen affinity purified
Immunogen This antibody was developed against Recombinant Protein corresponding to amino acids: NQGLLYDRSWMVVNHNGVCLSQKQEPRLCLIQPFIDLRQRIMVIKAKGME PIEVPLEENSERTQIRQSRVCADRVSTYDCGEKISSWLSTFFGRPCHLIK QSSNSQRNAKKK
Isotype IgG

Target Details MOCOS

Product Details anti-MOCOS Antibody Application Details Handling References for anti-MOCOS antibody (ABIN4335161) Images back to top
Antigen
Alternative Name MOCOS (MOCOS Antibody Abstract)
Background Gene Symbol: MOCOS
Gene ID 55034
Pathways Response to Water Deprivation, ER-Nucleus Signaling

Application Details

Product Details anti-MOCOS Antibody Target Details MOCOS Handling References for anti-MOCOS antibody (ABIN4335161) Images back to top
Application Notes Western Blot 1:250 - 1:500, Simple Western 1:30, Immunohistochemistry, Immunocytochemistry/Immunofluorescence, Immunohistochemistry-Paraffin 1:50 - 1:200This product has been validated for use in IHC-Paraffin Embedded Tissues. HIER pH 6 antigen retrieval is recommended. Use in Immunocytochemistry/immunofluorescence reported in scientific literature (PMID 26239292). In Simple Western only 10 - 15 μL of the recommended dilution is used per data point. Separated by Size-Wes, Sally Sue/Peggy Sue.
Comment

The antibodies are intended for use in vitro experiments only. Our antibodies have not been tested nor are recommended for use in vivo.

Restrictions For Research Use only

Handling

Product Details anti-MOCOS Antibody Target Details MOCOS Application Details References for anti-MOCOS antibody (ABIN4335161) Images back to top
Format Liquid
Buffer PBS ( pH 7.2) and 40 % Glycerol
Buffer contains: 0.02 % Sodium Azide
Preservative Sodium azide
Precaution of Use This product contains Sodium azide: a POISONOUS AND HAZARDOUS SUBSTANCE which should be handled by trained staff only.
Storage 4 °C,-20 °C
Storage Comment Store at 4°C short term. Aliquot and store at -20°C long term. Avoid freeze-thaw cycles.

References for anti-MOCOS antibody (ABIN4335161)

Product Details anti-MOCOS Antibody Target Details MOCOS Application Details Handling Images back to top
Product cited in:

Féron, Gepner, Lacassagne, Stephan, Mesnage, Blanchard, Boulanger, Tardif, Devèze, Rousseau, Suzuki, Izpisua Belmonte, Khrestchatisky, Nivet, Erard-Garcia: "Olfactory stem cells reveal MOCOS as a new player in autism spectrum disorders." in: Molecular psychiatry, Vol. 21, Issue 9, pp. 1215-24, 2016 Further details: Immunocytochemistry,Western Blotting,Immunofluorescence,Immunohistochemistry

Images

Product Details anti-MOCOS Antibody Target Details MOCOS Application Details Handling References for anti-MOCOS antibody (ABIN4335161) back to top
Supplier Images
Western Blotting (WB) image for anti-Molybdenum Cofactor Sulfurase (MOCOS) antibody (ABIN4335161) Western Blot: MOCOS Antibody [NBP2-14243] - Lane 1: Marker [kDa] 250, 130, 95, 72, 55...
Immunohistochemistry (Paraffin-embedded Sections) (IHC (p)) image for anti-Molybdenum Cofactor Sulfurase (MOCOS) antibody (ABIN4335161) Immunohistochemistry-Paraffin: MOCOS Antibody [NBP2-14243] - Staining of human stomac...
Simple Western (SimWes) image for anti-Molybdenum Cofactor Sulfurase (MOCOS) antibody (ABIN4335161) Simple Western: MOCOS Antibody [NBP2-14243] - Simple Western lane view shows a specif...
Simple Western (SimWes) image for anti-Molybdenum Cofactor Sulfurase (MOCOS) antibody (ABIN4335161) Simple Western: MOCOS Antibody [NBP2-14243] - Electropherogram image(s) of correspond...
Immunofluorescence (IF) image for anti-Molybdenum Cofactor Sulfurase (MOCOS) antibody (ABIN4335161) Immunocytochemistry/Immunofluorescence: MOCOS Antibody - Immunofluorescent staining ...