anti-Rat (Rattus) HER2 antibody for Immunohistochemistry (Paraffin-embedded Sections)

Recommended HER2 Antibody (supplied by: Log in to see )

Antigen
V-Erb-B2 erythroblastic Leukemia Viral Oncogene Homolog 2, Neuro/glioblastoma Derived Oncogene Homolog (Avian) (ERBB2) Antibodies
  • CD340
  • HER-2
  • HER-2/neu
  • HER2
  • MLN 19
  • NEU
  • NGL
  • TKR1
  • Erbb-2
  • Neu
  • c-erbB2
  • c-neu
  • mKIAA3023
  • wu:fv70f10
  • zgc:63601
  • erb2
  • erb-b2 receptor tyrosine kinase 2
  • ERBB2
  • Erbb2
  • erbb2
Epitope
AA 29-64, N-Term
130
87
71
69
60
48
48
35
31
25
23
22
22
15
14
13
13
13
12
12
12
11
11
11
11
10
10
10
10
10
10
9
9
8
7
7
7
6
6
6
6
5
5
5
5
4
4
4
4
4
3
3
3
3
3
3
3
2
2
2
2
2
2
2
2
2
2
2
2
2
2
2
1
1
1
1
1
1
1
1
1
1
1
1
1
1
1
1
1
1
1
1
1
1
1
1
1
1
1
1
1
1
1
1
1
1
1
1
Reactivity
Human, Rat (Rattus)
1294
405
312
31
22
10
6
6
6
4
4
3
3
3
3
3
2
2
2
2
1
1
1
Host
Rabbit
772
584
23
16
10
3
3
Clonality
Polyclonal
Conjugate
This HER2 antibody is un-conjugated
57
44
44
42
41
27
18
18
11
11
11
10
10
9
8
8
8
8
8
6
6
6
6
6
6
6
6
6
6
6
6
6
6
6
6
6
6
6
6
6
6
6
2
2
1
Application
Immunohistochemistry (Paraffin-embedded Sections) (IHC (p)), Western Blotting (WB)
671
453
412
411
352
192
191
102
100
99
96
47
24
21
18
11
6
3
3
3
2
1
1
1
1
1
1
1
1
Options
Supplier
Log in to see
Supplier Product No.
Log in to see
Request

Get this product for free

Submit your validation data for this product and get a full refund. I want to validate this product

Learn more

Available images

Catalog No. ABIN5518830
$ 280.00
Plus shipping costs $45.00
Relevance Score ABIN Application Conjugate Host Isotype Epitope Supplier Clonality References Details
11.117381 ABIN305740 IHC IHC (fro) IHC (p) IP WB Rabbit IgG AA 1243-1255 Log in to see Polyclonal 0
11.117381 ABIN213613 IHC IHC (p) Rabbit Cytoplasmic Domain Log in to see Polyclonal 0
11.117381 ABIN295912 ICC IHC IHC (p) WB Chicken IgY AA 153-433 Log in to see Polyclonal 0
11.117381 ABIN498415 IF IHC (p) WB Rabbit Log in to see Polyclonal 0
11.117381 ABIN498846 IHC (p) Rabbit pTyr877 Log in to see Polyclonal 0
11.117381 ABIN498847 IHC (p) Rabbit pTyr1248 Log in to see Polyclonal 0
10 ABIN197226 IF IHC (p) WB Rabbit AA 1246-1250 Log in to see Polyclonal 4
10 ABIN2889975 ELISA IF IHC IHC (p) WB Rabbit IgG AA 641-690 Log in to see Polyclonal 0
8.117381 ABIN498936 IHC (p) Rabbit Log in to see Polyclonal 0
8.117381 ABIN498935 IHC (p) Rabbit Log in to see Polyclonal 0
7 ABIN197222 IHC (p) WB Rabbit Tyr877 Log in to see Polyclonal 3
7 ABIN318038 EIA IHC (p) IP WB Rabbit pTyr877 Log in to see Polyclonal 0
7 ABIN265464 EIA IHC (p) WB Rabbit Log in to see Polyclonal 0
7 ABIN265465 EIA IHC (p) WB Rabbit Log in to see Polyclonal 0
7 ABIN265462 IHC (p) WB Rabbit Log in to see Polyclonal 0
7 ABIN318037 IHC (p) WB Rabbit pTyr1248 Log in to see Polyclonal 0
7 ABIN318035 IHC (p) IP WB Rabbit pTyr1221, pTyr1222 Log in to see Polyclonal 0
7 ABIN317887 IHC (p) WB Rabbit Log in to see Polyclonal 0
7 ABIN187280 IHC (p) IP WB Mouse IgG1 Log in to see Cocktail 0
4 ABIN372478 IHC (fro) IHC (p) IP WB Rabbit IgG AA 1243-1255 Log in to see Polyclonal 0

General

Antigen V-Erb-B2 erythroblastic Leukemia Viral Oncogene Homolog 2, Neuro/glioblastoma Derived Oncogene Homolog (Avian) (ERBB2) Antibodies
Epitope AA 29-64, N-Term
(130), (87), (71), (69), (60), (48), (48), (35), (31), (25), (23), (22), (22), (15), (14), (13), (13), (13), (12), (12), (12), (11), (11), (11), (11), (10), (10), (10), (10), (10), (10), (9), (9), (8), (7), (7), (7), (6), (6), (6), (6), (5), (5), (5), (5), (4), (4), (4), (4), (4), (3), (3), (3), (3), (3), (3), (3), (2), (2), (2), (2), (2), (2), (2), (2), (2), (2), (2), (2), (2), (2), (2), (1), (1), (1), (1), (1), (1), (1), (1), (1), (1), (1), (1), (1), (1), (1), (1), (1), (1), (1), (1), (1), (1), (1), (1), (1), (1), (1), (1), (1), (1), (1), (1), (1), (1), (1), (1)
Reactivity Human, Rat (Rattus)
(1294), (405), (312), (31), (22), (10), (6), (6), (6), (4), (4), (3), (3), (3), (3), (3), (2), (2), (2), (2), (1), (1), (1)
Host Rabbit
(772), (584), (23), (16), (10), (3), (3)
Clonality
Polyclonal
Conjugate This HER2 antibody is un-conjugated
(57), (44), (44), (42), (41), (27), (18), (18), (11), (11), (11), (10), (10), (9), (8), (8), (8), (8), (8), (6), (6), (6), (6), (6), (6), (6), (6), (6), (6), (6), (6), (6), (6), (6), (6), (6), (6), (6), (6), (6), (6), (6), (2), (2), (1)
Application Immunohistochemistry (Paraffin-embedded Sections) (IHC (p)), Western Blotting (WB)
(671), (453), (412), (411), (352), (192), (191), (102), (100), (99), (96), (47), (24), (21), (18), (11), (6), (3), (3), (3), (2), (1), (1), (1), (1), (1), (1), (1), (1)
Pubmed 2 references available
Supplier Log in to see

Product Details anti-HER2 Antibody

Target Details HER2 Application Details Handling References for anti-HER2 antibody (ABIN5518830) Images
Purpose Rabbit IgG polyclonal antibody for Receptor tyrosine-protein kinase erbB-2(ERBB2) detection. Tested with WB, IHC-P in Human,Rat.
Sequence TDMKLRLPAS PETHLDMLRH LYQGCQVVQG NLELTY
Cross-Reactivity (Details) No cross reactivity with other proteins.
Characteristics Rabbit IgG polyclonal antibody for Receptor tyrosine-protein kinase erbB-2(ERBB2) detection. Tested with WB, IHC-P in Human,Rat.
Gene Name: erb-b2 receptor tyrosine kinase 2
Protein Name: Receptor tyrosine-protein kinase erbB-2
Purification Immunogen affinity purified.
Immunogen A synthetic peptide corresponding to a sequence at the N-terminus of human ErbB 2 (29-64aa TDMKLRLPASPETHLDMLRHLYQGCQVVQGNLELTY), identical to the related mouse and rat sequences.
Isotype IgG
Plasmids, Primers & others

Target Details HER2

Product Details anti-HER2 Antibody Application Details Handling References for anti-HER2 antibody (ABIN5518830) Images back to top
Antigen
Alternative Name ERBB2 (ERBB2 Antibody Abstract)
Background Receptor tyrosine-protein kinase erbB-2, also known as CD340 (cluster of differentiation 340), proto-oncogene Neu, Erbb2 (rodent), or ERBB2 (human), is a protein that in humans is encoded by the ERBB2 gene. And it is also frequently called HER2 (from human epidermal growth factor receptor 2) or HER2/neu. This gene encodes a member of the epidermal growth factor (EGF) receptor family of receptor tyrosine kinases. This protein has no ligand binding domain of its own and therefore cannot bind growth factors. Amplification and/or overexpression of this gene has been reported in numerous cancers, including breast and ovarian tumors. Alternative splicing results in several additional transcript variants, some encoding different isoforms and others that have not been fully characterized.

Synonyms: C erb B2/neu protein | Cerb B2/neu protein | CD340 | CD340 antigen | CerbB2 | ERBB2 | HER 2 | HER 2/NEU | HER2 | Herstatin | MLN19 | MLN 19 | NEU | NGL | p185erbB2 | TKR1 | P04626
Gene ID 2064
UniProt P04626
Pathways RTK Signaling, Fc-epsilon Receptor Signaling Pathway, EGFR Signaling Pathway, Neurotrophin Signaling Pathway, Skeletal Muscle Fiber Development

Application Details

Product Details anti-HER2 Antibody Target Details HER2 Handling References for anti-HER2 antibody (ABIN5518830) Images back to top
Application Notes WB: Concentration: 0.1-0.5 μg/mL, Tested Species: Human
IHC-P: Concentration: 0.5-1 μg/mL, Tested Species: Human, Rat, Epitope Retrieval by Heat: Boiling the paraffin sections in 10 mM citrate buffer, pH 6.0, for 20 mins is required for the staining of formalin/paraffin sections.
Notes: Tested Species: Species with positive results. Other applications have not been tested. Optimal dilutions should be determined by end users.
Comment

Antibody can be supported by chemiluminescence kit ABIN921124 in WB, supported by ABIN921231 in IHC(P).

Restrictions For Research Use only

Handling

Product Details anti-HER2 Antibody Target Details HER2 Application Details References for anti-HER2 antibody (ABIN5518830) Images back to top
Format Lyophilized
Reconstitution Add 0.2 mL of distilled water will yield a concentration of 500 μg/mL.
Concentration 500 μg/mL
Buffer Each vial contains 5 mg BSA, 0.9 mg NaCl, 0.2 mg Na2HPO4, 0.05 mg Sodium azide.
Preservative Sodium azide
Precaution of Use This product contains Sodium azide: a POISONOUS AND HAZARDOUS SUBSTANCE which should be handled by trained staff only.
Storage 4 °C,-20 °C
Storage Comment At -20°C for one year. After reconstitution, at 4°C for one month.
It can also be aliquotted and stored frozen at -20 °C for a longer time. Avoid repeated freezing and thawing.

References for anti-HER2 antibody (ABIN5518830)

Product Details anti-HER2 Antibody Target Details HER2 Application Details Handling Images back to top
Product cited in:

Zhang, Zhang, Ruan, Zhang, He, Gao: "Lapatinib-incorporated lipoprotein-like nanoparticles: preparation and a proposed breast cancer-targeting mechanism." in: Acta pharmacologica Sinica, Vol. 35, Issue 6, pp. 846-52, 2015

Tao, Suhua, Juanjuan, Zongzhi, Juan, Dandan: "In vitro study on human cytomegalovirus affecting early pregnancy villous EVT's invasion function." in: Virology journal, Vol. 8, pp. 114, 2011

Images

Product Details anti-HER2 Antibody Target Details HER2 Application Details Handling References for anti-HER2 antibody (ABIN5518830) back to top
Supplier Images
Western Blotting (WB) image for anti-V-Erb-B2 erythroblastic Leukemia Viral Oncogene Homolog 2, Neuro/glioblastoma Derived Oncogene Homolog (Avian) (ERBB2) (AA 29-64), (N-Term) antibody (ABIN5518830) Western blot analysis of ErbB 2 using anti- ErbB 2 antibody . Electrophoresis was pe...
Immunohistochemistry (IHC) image for anti-V-Erb-B2 erythroblastic Leukemia Viral Oncogene Homolog 2, Neuro/glioblastoma Derived Oncogene Homolog (Avian) (ERBB2) (AA 29-64), (N-Term) antibody (ABIN5518830) IHC analysis of ErbB 2 using anti- ErbB 2 antibody . ErbB 2 was detected in paraffin-...
Immunohistochemistry (IHC) image for anti-V-Erb-B2 erythroblastic Leukemia Viral Oncogene Homolog 2, Neuro/glioblastoma Derived Oncogene Homolog (Avian) (ERBB2) (AA 29-64), (N-Term) antibody (ABIN5518830) IHC analysis of ErbB 2 using anti- ErbB 2 antibody . ErbB 2 was detected in paraffin-...