anti-Cat (Feline) VEGF antibody for Immunofluorescence

Recommended VEGF Antibody (supplied by: Log in to see )

Antigen
Vascular Endothelial Growth Factor A (VEGFA) Antibodies
  • vegf
  • vegfa
  • wu:fj82c06
  • VEGF
  • vegf-a
  • vpf
  • vefg
  • VEGF-A
  • VPF
  • eVEGF120
  • eVEGF164
  • MVCD1
  • Vegf
  • Vegf120
  • Vegf164
  • Vegf188
  • Vpf
  • VEGF164
  • vascular endothelial growth factor Aa
  • vascular endothelial growth factor A L homeolog
  • vascular endothelial growth factor A
  • vegfaa
  • vegfa.L
  • VEGFA
  • vegfa
  • Vegfa
Reactivity
Cat (Feline), Chicken, Cow (Bovine), Dog (Canine), Donkey, Goat, Guinea Pig, Hamster, Horse (Equine), Human, Monkey, Mouse (Murine), Pig (Porcine), Rabbit, Rat (Rattus), Sheep (Ovine)
282
116
112
23
18
15
14
8
2
2
2
1
1
1
Host
Goat
261
90
23
4
2
1
1
Clonality
Polyclonal
Conjugate
This VEGF antibody is un-conjugated
42
23
12
5
5
4
3
3
3
3
3
2
2
2
2
2
2
1
1
1
1
1
Application
Immunofluorescence (IF), Western Blotting (WB)
287
170
83
62
26
26
19
17
17
15
12
11
7
5
4
2
2
1
1
1
Supplier
Log in to see
Supplier Product No.
Log in to see
Request

Get this product for free

Submit your validation data for this product and get a full refund. I want to validate this product

Learn more

Catalog No. ABIN2629817
$ 581.17
Plus shipping costs $45.00

General

Antigen Vascular Endothelial Growth Factor A (VEGFA) Antibodies
Reactivity Cat (Feline), Chicken, Cow (Bovine), Dog (Canine), Donkey, Goat, Guinea Pig, Hamster, Horse (Equine), Human, Monkey, Mouse (Murine), Pig (Porcine), Rabbit, Rat (Rattus), Sheep (Ovine)
(282), (116), (112), (23), (18), (15), (14), (8), (2), (2), (2), (1), (1), (1)
Host Goat
(261), (90), (23), (4), (2), (1), (1)
Clonality
Polyclonal
Conjugate This VEGF antibody is un-conjugated
(42), (23), (12), (5), (5), (4), (3), (3), (3), (3), (3), (2), (2), (2), (2), (2), (2), (1), (1), (1), (1), (1)
Application Immunofluorescence (IF), Western Blotting (WB)
(287), (170), (83), (62), (26), (26), (19), (17), (17), (15), (12), (11), (7), (5), (4), (2), (2), (1), (1), (1)
Supplier Log in to see

Product Details anti-VEGF Antibody

Target Details VEGF Application Details Handling Images
Specificity Detects endogenous levels of total VEGFA by Western blot in whole cell and tissue lysates.
Purification Immunoaffinity purified
Immunogen Purified recombinant human VEGFA isoform 6 produced in E. coli. corresponding to P15692-6 (MNFLLSWVHWSLALLLYLHHAKWSQAAPMAEGGGQNHHEVVKFMDVYQRSYCHPIETLVD)
Isotype IgG

Target Details VEGF

Product Details anti-VEGF Antibody Application Details Handling Images back to top
Antigen
Alternative Name VEGFA / VEGF (VEGFA Antibody Abstract)
Background Name/Gene ID: VEGFA
Family: PDGF

Synonyms: VEGFA, VPF, Vascular permeability factor, VEGF, VEGF-A, MVCD1
Gene ID 7422
UniProt P15692
Pathways RTK Signaling, Glycosaminoglycan Metabolic Process, Regulation of Cell Size, Tube Formation, Signaling Events mediated by VEGFR1 and VEGFR2, Platelet-derived growth Factor Receptor Signaling, VEGFR1 Specific Signals, VEGF Signaling

Application Details

Product Details anti-VEGF Antibody Target Details VEGF Handling Images back to top
Application Notes Approved: IF (1:50 - 1:250), WB (1:500 - 1:2000)
Comment

Target Species of Antibody: Human

Restrictions For Research Use only

Handling

Product Details anti-VEGF Antibody Target Details VEGF Application Details Images back to top
Format Liquid
Concentration Lot specific
Buffer PBS, 20 % glycerol, 0.05 % sodium azide.
Preservative Sodium azide
Precaution of Use This product contains Sodium azide: a POISONOUS AND HAZARDOUS SUBSTANCE which should be handled by trained staff only.
Handling Advice Avoid repeated freezing and thawing.
Storage 4 °C,-20 °C
Storage Comment Store at 4°C short term. Aliquot and store at -20°C long term. Avoid freeze-thaw cycles.