anti-Human SALL4 antibody for Immunohistochemistry (Paraffin-embedded Sections)

Recommended SALL4 Antibody (supplied by: Log in to see )

Antigen
Sal-Like 4 (Drosophila) (SALL4) Antibodies
  • SALL4
  • drrs
  • sall4a
  • znf797
  • MGC81541
  • hsal4
  • MGC76059
  • cb614
  • sb:cb372
  • sb:cb614
  • wu:fa01g03
  • ik:tdsubc_2c1
  • xx:tdsubc_2c1
  • 5730441M18Rik
  • AA407717
  • AL022809
  • AW536104
  • C330011P20Rik
  • C78083
  • C78563
  • Tex20
  • DRRS
  • HSAL4
  • ZNF797
  • dJ1112F19.1
  • spalt like transcription factor 4
  • sal-like 4 (Drosophila)
  • spalt-like transcription factor 4 L homeolog
  • spalt-like transcription factor 4
  • SALL4
  • sall4
  • sall4.L
  • Sall4
Reactivity
Human
74
22
18
6
5
4
2
2
2
Host
Rabbit
63
17
16
Clonality
Polyclonal
Conjugate
This SALL4 antibody is un-conjugated
5
3
3
3
3
3
Application
Immunocytochemistry (ICC), Immunofluorescence (IF), Immunohistochemistry (IHC), Immunohistochemistry (Paraffin-embedded Sections) (IHC (p)), Western Blotting (WB)
79
51
18
12
7
7
3
3
2
2
1
Supplier
Log in to see
Supplier Product No.
Log in to see
Request

Get this product for free

Submit your validation data for this product and get a full refund. I want to validate this product

Learn more

Available images

Catalog No. ABIN4351917
Contact our Customer Service for availability and price in your country.
Relevance Score ABIN Application Conjugate Host Isotype Epitope Supplier Clonality References Details
9.969353 ABIN442916 ICC IF IHC (p) IHC WB Rabbit IgG Center Log in to see Polyclonal 0
9.969353 ABIN213956 ELISA IHC IHC (p) Rabbit AA 28-42 Log in to see Polyclonal 0
1 ABIN566099 IHC (p) ELISA WB Mouse IgG1 kappa AA 954-1053, partial Log in to see 6E3 17
1 ABIN1027551 IHC (p) Mouse IgG1 kappa Log in to see 0
1 ABIN1027550 IHC (p) Mouse IgG1 kappa Log in to see 0
1 ABIN1739022 IHC (p) ELISA Rabbit IgG Log in to see Polyclonal 0
1 ABIN4351918 ICC IF IHC IHC (p) Rabbit IgG Log in to see Polyclonal 0
1 ABIN5774997 IHC (p) Rabbit IgG C-Term Log in to see SP289 0
1 ABIN5572614 IHC (p) Mouse IgG1 kappa AA 954-1053 Log in to see 6E3 0
1 ABIN3200754 ELISA IHC (p) WB Rabbit AA 493-526, Internal Region Log in to see Polyclonal 0

General

Antigen Sal-Like 4 (Drosophila) (SALL4) Antibodies
Reactivity Human
(74), (22), (18), (6), (5), (4), (2), (2), (2)
Host Rabbit
(63), (17), (16)
Clonality
Polyclonal
Conjugate This SALL4 antibody is un-conjugated
(5), (3), (3), (3), (3), (3)
Application Immunocytochemistry (ICC), Immunofluorescence (IF), Immunohistochemistry (IHC), Immunohistochemistry (Paraffin-embedded Sections) (IHC (p)), Western Blotting (WB)
(79), (51), (18), (12), (7), (7), (3), (3), (2), (2), (1)
Supplier Log in to see

Product Details anti-SALL4 Antibody

Target Details SALL4 Application Details Handling Images
Specificity Specificity of antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins.
Purification Immunogen affinity purified
Immunogen This antibody was developed against Recombinant Protein corresponding to amino acids:HALHSSGAGADTLKTLGSHMSQQVSAAVALLSQKAGSQGLSLDALKQAKLPHANIPSATSSLSPGLAPFTLKPDGTRVLPNVMSRLPSALLPQAPGSVLFQSPFSTVALDTSKKGKGKPPNISAVDVKPKDE
Isotype IgG
Plasmids, Primers & others

Target Details SALL4

Product Details anti-SALL4 Antibody Application Details Handling Images back to top
Antigen
Alternative Name SALL4 (SALL4 Antibody Abstract)
Background Gene Symbol: SALL4
Gene ID 57167
Pathways Stem Cell Maintenance, Tube Formation

Application Details

Product Details anti-SALL4 Antibody Target Details SALL4 Handling Images back to top
Application Notes Western Blot 1:100 - 1:250, Immunohistochemistry, Immunocytochemistry/Immunofluorescence 1 - 4 μg/mL, Immunohistochemistry-Paraffin 1:20 - 1:50For HIER pH 6 retrieval is recommended.
Comment

The antibodies are intended for use in vitro experiments only. Our antibodies have not been tested nor are recommended for use in vivo.

Restrictions For Research Use only

Handling

Product Details anti-SALL4 Antibody Target Details SALL4 Application Details Images back to top
Format Liquid
Buffer PBS ( pH 7.2) and 40 % Glycerol
Buffer contains: 0.02 % Sodium Azide
Preservative Sodium azide
Precaution of Use This product contains Sodium azide: a POISONOUS AND HAZARDOUS SUBSTANCE which should be handled by trained staff only.
Storage 4 °C,-20 °C
Storage Comment Store at 4°C short term. Aliquot and store at -20°C long term. Avoid freeze-thaw cycles.

Images

Product Details anti-SALL4 Antibody Target Details SALL4 Application Details Handling back to top
Supplier Images
Immunohistochemistry (Paraffin-embedded Sections) (IHC (p)) image for anti-Sal-Like 4 (Drosophila) (SALL4) antibody (ABIN4351917) Immunohistochemistry-Paraffin: Sall4 Antibody [NBP1-84247] - Staining of human ovary ...
Western Blotting (WB) image for anti-Sal-Like 4 (Drosophila) (SALL4) antibody (ABIN4351917) Western Blot: Sall4 Antibody [NBP1-84247] - Lane 1: Marker [kDa] 230, 130, 95, 72, 56...
Immunofluorescence (Paraffin-embedded Sections) (IF (p)) image for anti-Sal-Like 4 (Drosophila) (SALL4) antibody (ABIN4351917) Immunohistochemistry-Paraffin: SALL4 Antibody - Staining of human skeletal muscle sh...
Immunofluorescence (Paraffin-embedded Sections) (IF (p)) image for anti-Sal-Like 4 (Drosophila) (SALL4) antibody (ABIN4351917) Immunohistochemistry-Paraffin: SALL4 Antibody - Staining of human testis shows weak ...
Immunofluorescence (IF) image for anti-Sal-Like 4 (Drosophila) (SALL4) antibody (ABIN4351917) Immunocytochemistry/Immunofluorescence: SALL4 Antibody - Immunofluorescent staining ...
Immunohistochemistry (Paraffin-embedded Sections) (IHC (p)) image for anti-Sal-Like 4 (Drosophila) (SALL4) antibody (ABIN4351917) Immunohistochemistry-Paraffin: SALL4 Antibody - Staining in human testis and skeleta...