anti-Rat (Rattus) CAMK2B antibody for Immunohistochemistry (Paraffin-embedded Sections)

Recommended CAMK2B Antibody (supplied by: Log in to see )

Calcium/calmodulin-Dependent Protein Kinase (CaM Kinase) II beta (CAMK2B) Antibodies
  • CAMK2B
  • camk2
  • camk2b
  • cam2
  • camkb
  • CAM2
  • CAMK2
  • Ck2b
  • CAMK1
  • Camk2
  • Camki
  • Camk2d
  • calcium/calmodulin dependent protein kinase II beta
  • calcium/calmodulin-dependent protein kinase (CaM kinase) II beta
  • calcium/calmodulin dependent protein kinase (CaM kinase) II alpha S homeolog
  • calcium/calmodulin dependent protein kinase (CaM kinase) II beta L homeolog
  • calcium/calmodulin-dependent protein kinase II beta
  • calcium/calmodulin-dependent protein kinase II delta
  • calcium/calmodulin-dependent protein kinase II, beta
  • CAMK2B
  • camk2a.S
  • camk2b.L
  • Camk2b
  • Camk2d
Human, Mouse (Murine), Rat (Rattus)
This CAMK2B antibody is un-conjugated
Immunocytochemistry (ICC), Immunofluorescence (IF), Immunohistochemistry (IHC), Immunohistochemistry (Paraffin-embedded Sections) (IHC (p)), In vivo Studies (in vivo), Simple Western (SimWes), Western Blotting (WB)
Log in to see
Supplier Product No.
Log in to see

Get this product for free

Submit your validation data for this product and get a full refund. I want to validate this product

Learn more

Available images

Catalog No. ABIN4287584
Contact our Customer Service for availability and price in your country.
Relevance Score ABIN Application Conjugate Host Isotype Epitope Supplier Clonality References Details
12.484504 ABIN499009 IHC (p) WB Rabbit Log in to see Polyclonal
1 ABIN768905 Func IHC (p) IP ELISA WB Mouse IgG2b, kappa Log in to see
1 ABIN2617864 IHC (p) WB Rabbit C-Term Log in to see Polyclonal
1 ABIN337356 IHC (p) WB Rabbit pThr286 Log in to see Polyclonal
1 ABIN4287583 ICC IF IHC IHC (p) in vivo SimWes WB Rabbit IgG Log in to see Polyclonal
1 ABIN4219082 IHC (p) WB Rabbit pThr287 Log in to see Polyclonal
1 ABIN462429 IHC (p) WB Rabbit Log in to see Polyclonal
1 ABIN1732578 IHC (p) WB Rabbit IgG pThr286 Log in to see Polyclonal
1 ABIN2794017 IHC (p) WB Rabbit pThr286 Log in to see Polyclonal


Antigen Calcium/calmodulin-Dependent Protein Kinase (CaM Kinase) II beta (CAMK2B) Antibodies
Reactivity Human, Mouse (Murine), Rat (Rattus)
(104), (69), (68), (8), (7), (6), (5), (5), (4), (4), (4), (3), (3), (1), (1), (1), (1), (1)
Host Rabbit
(81), (46)
Conjugate This CAMK2B antibody is un-conjugated
(3), (3), (3), (3), (3), (3), (3), (3), (2), (1), (1), (1), (1), (1), (1), (1), (1), (1), (1), (1)
Application Immunocytochemistry (ICC), Immunofluorescence (IF), Immunohistochemistry (IHC), Immunohistochemistry (Paraffin-embedded Sections) (IHC (p)), In vivo Studies (in vivo), Simple Western (SimWes), Western Blotting (WB)
(109), (62), (31), (28), (25), (18), (9), (6), (3), (1), (1), (1), (1), (1)
Supplier Log in to see

Product Details anti-CAMK2B Antibody

Target Details CAMK2B Application Details Handling Images
Specificity Specificity of antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins.
Purification Immunogen affinity purified
Immunogen This antibody was developed against Recombinant Protein corresponding to amino acids:TRNFSVGRQTTAPATMSTAASGTTMGLVEQAKSLLNKKADGVKPQTNSTKNSAAATSPKGTLPPAALEPQTTVIH
Isotype IgG

Target Details CAMK2B

Product Details anti-CAMK2B Antibody Application Details Handling Images back to top
Alternative Name CaMKII beta (CAMK2B Antibody Abstract)
Background Gene Symbol: CAMK2B
Gene ID 816
Research Area Kinases/Phosphatases, Cell Cycle, Chromatin and Nuclear Signaling
Pathways WNT Signaling, Interferon-gamma Pathway, Myometrial Relaxation and Contraction, Regulation of G-Protein Coupled Receptor Protein Signaling, Smooth Muscle Cell Migration, Regulation of long-term Neuronal Synaptic Plasticity

Application Details

Product Details anti-CAMK2B Antibody Target Details CAMK2B Handling Images back to top
Application Notes Western Blot 1:500 - 1:1000, Simple Western 1:5, Immunohistochemistry, Immunocytochemistry/Immunofluorescence, Immunohistochemistry-Paraffin 1:200 - 1:500, In vivo assayFor HIER pH 6 retrieval is recommended. WB dilution: 1:100-1:500 (Rodent material) and 1:500-1:1000 (Human material). In Simple Western only 10-15 μL of the recommended dilution is used per data point.

The antibodies are intended for use in vitro experiments only. Our antibodies have not been tested nor are recommended for use in vivo.

Restrictions For Research Use only


Product Details anti-CAMK2B Antibody Target Details CAMK2B Application Details Images back to top
Format Liquid
Buffer PBS ( pH 7.2) and 40 % Glycerol
Buffer contains: 0.02 % Sodium Azide
Preservative Sodium azide
Precaution of Use This product contains Sodium azide: a POISONOUS AND HAZARDOUS SUBSTANCE which should be handled by trained staff only.
Storage 4 °C,-20 °C
Storage Comment Store at 4°C short term. Aliquot and store at -20°C long term. Avoid freeze-thaw cycles.


Product Details anti-CAMK2B Antibody Target Details CAMK2B Application Details Handling back to top
Supplier Images
Immunofluorescence (IF) image for anti-Calcium/calmodulin-Dependent Protein Kinase (CaM Kinase) II beta (CAMK2B) antibody (ABIN4287584) Immunocytochemistry/Immunofluorescence: CaMKII beta Antibody [NBP1-88212] - Staining ...
Immunohistochemistry (IHC) image for anti-Calcium/calmodulin-Dependent Protein Kinase (CaM Kinase) II beta (CAMK2B) antibody (ABIN4287584) Immunohistochemistry: CaMKII beta Antibody [NBP1-88212] - Staining of human lateral v...
Immunohistochemistry (Paraffin-embedded Sections) (IHC (p)) image for anti-Calcium/calmodulin-Dependent Protein Kinase (CaM Kinase) II beta (CAMK2B) antibody (ABIN4287584) Immunohistochemistry-Paraffin: CaMKII beta Antibody [NBP1-88212] - Staining of human ...
Simple Western (SimWes) image for anti-Calcium/calmodulin-Dependent Protein Kinase (CaM Kinase) II beta (CAMK2B) antibody (ABIN4287584) Simple Western: CaMKII beta Antibody [NBP1-88212] - Electropherogram image of the cor...
Immunofluorescence (IF) image for anti-Calcium/calmodulin-Dependent Protein Kinase (CaM Kinase) II beta (CAMK2B) antibody (ABIN4287584) Immunocytochemistry/Immunofluorescence: CaMKII beta Antibody [NBP1-88212] - Staining ...
Immunofluorescence (IF) image for anti-Calcium/calmodulin-Dependent Protein Kinase (CaM Kinase) II beta (CAMK2B) antibody (ABIN4287584) Immunocytochemistry/Immunofluorescence: CaMKII beta Antibody [NBP1-88212] - Staining ...
 image for anti-Calcium/calmodulin-Dependent Protein Kinase (CaM Kinase) II beta (CAMK2B) antibody (ABIN4287584) In vivo assay: CaMKII beta Antibody [NBP1-88212] - Lane 1: NIH-3T3 cell lysate (Mouse...
Immunohistochemistry (Paraffin-embedded Sections) (IHC (p)) image for anti-Calcium/calmodulin-Dependent Protein Kinase (CaM Kinase) II beta (CAMK2B) antibody (ABIN4287584) Immunohistochemistry-Paraffin: CaMKII beta Antibody [NBP1-88212] - Staining of human ...
Immunofluorescence (IF) image for anti-Calcium/calmodulin-Dependent Protein Kinase (CaM Kinase) II beta (CAMK2B) antibody (ABIN4287584) Immunocytochemistry/Immunofluorescence: CaMKII beta Antibody [NBP1-88212] - Staining ...
Simple Western (SimWes) image for anti-Calcium/calmodulin-Dependent Protein Kinase (CaM Kinase) II beta (CAMK2B) antibody (ABIN4287584) Simple Western: CaMKII beta Antibody [NBP1-88212] - Simple Western lane view shows a ...
Immunofluorescence (IF) image for anti-Calcium/calmodulin-Dependent Protein Kinase (CaM Kinase) II beta (CAMK2B) antibody (ABIN4287584) Immunocytochemistry/Immunofluorescence: CaMKII beta Antibody [NBP1-88212] - Staining ...
Immunohistochemistry (Paraffin-embedded Sections) (IHC (p)) image for anti-Calcium/calmodulin-Dependent Protein Kinase (CaM Kinase) II beta (CAMK2B) antibody (ABIN4287584) Immunohistochemistry-Paraffin: CaMKII beta Antibody [NBP1-88212] - Staining of human ...
Western Blotting (WB) image for anti-Calcium/calmodulin-Dependent Protein Kinase (CaM Kinase) II beta (CAMK2B) antibody (ABIN4287584) Western Blot: CaMKII beta Antibody [NBP1-88212] - Lane 1: Marker [kDa] 250, 130, 100,...