SLC18A3 antibody (N-Term)
-
- Target See all SLC18A3 Antibodies
- SLC18A3 (Solute Carrier Family 18 (Vesicular Acetylcholine), Member 3 (SLC18A3))
-
Binding Specificity
- AA 1-36, N-Term
-
Reactivity
- Human, Mouse
-
Host
- Rabbit
-
Clonality
- Polyclonal
-
Conjugate
- This SLC18A3 antibody is un-conjugated
-
Application
- Western Blotting (WB)
- Purpose
- Rabbit IgG polyclonal antibody for Vesicular acetylcholine transporter(SLC18A3) detection. Tested with WB in Human,Mouse.
- Sequence
- MESAEPAGQA RAAATKLSEA VGAALQEPRR QRRLVL
- Cross-Reactivity (Details)
- No cross reactivity with other proteins.
- Characteristics
-
Rabbit IgG polyclonal antibody for Vesicular acetylcholine transporter(SLC18A3) detection. Tested with WB in Human,Mouse.
Gene Name: solute carrier family 18 member A3
Protein Name: Vesicular acetylcholine transporter - Purification
- Immunogen affinity purified.
- Immunogen
- A synthetic peptide corresponding to a sequence at the N-terminus of human SLC18A3 (1-36aa MESAEPAGQARAAATKLSEAVGAALQEPRRQRRLVL), different from the related mouse and rat sequences by five amino acids.
- Isotype
- IgG
- Top Product
- Discover our top product SLC18A3 Primary Antibody
-
-
- Application Notes
-
WB: Concentration: 0.1-0.5 μg/mL, Tested Species: Human, Mouse
Notes: Tested Species: Species with positive results.
Other applications have not been tested. Optimal dilutions should be determined by end users. - Comment
-
Antibody can be supported by chemiluminescence kit ABIN921124 in WB.
- Restrictions
- For Research Use only
-
- Format
- Lyophilized
- Reconstitution
- Add 0.2 mL of distilled water will yield a concentration of 500 μg/mL.
- Concentration
- 500 μg/mL
- Buffer
- Each vial contains 5 mg BSA, 0.9 mg NaCl, 0.2 mg Na2HPO4, 0.05 mg Sodium azide.
- Preservative
- Sodium azide
- Precaution of Use
- This product contains Sodium azide: a POISONOUS AND HAZARDOUS SUBSTANCE which should be handled by trained staff only.
- Handling Advice
- Avoid repeated freezing and thawing.
- Storage
- 4 °C/-20 °C
- Storage Comment
-
At -20°C for one year. After reconstitution, at 4°C for one month.
It can also be aliquotted and stored frozen at -20 °C for a longer time. Avoid repeated freezing and thawing.
-
- Target
- SLC18A3 (Solute Carrier Family 18 (Vesicular Acetylcholine), Member 3 (SLC18A3))
- Alternative Name
- SLC18A3 (SLC18A3 Products)
- Synonyms
- VACht antibody, rVAT antibody, Slc18a3 antibody, MGC64220 antibody, VACHT antibody, VAChT antibody, VAT antibody, SLC18A3 antibody, CG12345 antibody, CG32848 antibody, CT41182 antibody, Dmel\\CG32848 antibody, Vacht antibody, vAChT antibody, vacht antibody, VAChT-A antibody, zgc:153442 antibody, solute carrier family 18 member A3 antibody, solute carrier family 18 (vesicular acetylcholine transporter), member 3b antibody, solute carrier family 18 (vesicular monoamine), member 3 antibody, solute carrier family 18 (vesicular acetylcholine transporter), member 3 antibody, Vesicular acetylcholine transporter antibody, solute carrier family 18 (vesicular acetylcholine transporter), member 3a antibody, Slc18a3 antibody, slc18a3b antibody, SLC18A3 antibody, slc18a3 antibody, VAChT antibody, slc18a3a antibody
- Background
-
The Vesicular acetylcholine transporter (VAChT), also known as SLC18A3, is a neurotransmitter transporter which is responsible for loadingacetylcholine (ACh) into secretory organelles in neurons making acetylcholine available for secretion. It is encoded by Solute carrier family 18, member 3 (SLC18A3) gene. This gene is a member of the vesicular amine transporter family. The encoded transmembrane protein transports acetylcholine into secretory vesicles for release into the extracellular space. Acetylcholine transport utilizes a proton gradient established by a vacuolar ATPase. This gene is located within the first intron of the choline acetyltransferase gene.
Synonyms: AChR | Rvat | Slc18a3 | VAChT | Q16572 - Gene ID
- 6572
- UniProt
- Q16572
-