ABCA4 antibody (C-Term)
-
- Target See all ABCA4 Antibodies
- ABCA4 (ATP-Binding Cassette, Sub-Family A (ABC1), Member 4 (ABCA4))
-
Binding Specificity
- AA 1890-1927, C-Term
-
Reactivity
- Mouse, Rat
-
Host
- Rabbit
-
Clonality
- Polyclonal
-
Conjugate
- This ABCA4 antibody is un-conjugated
-
Application
- Western Blotting (WB)
- Purpose
- Rabbit IgG polyclonal antibody for Retinal-specific ATP-binding cassette transporter(ABCA4) detection. Tested with WB in Human,Mouse,Rat.
- Sequence
- FLLTLLVQRH FFLSQWIAEP TKEPIVDEDD DVAEERQR
- Cross-Reactivity (Details)
-
Predicted Cross Reactivity: human
No cross reactivity with other proteins.
Predicted Cross Reactivity: Species predicted to be fit for the product based on sequence similarities. - Characteristics
-
Rabbit IgG polyclonal antibody for Retinal-specific ATP-binding cassette transporter(ABCA4) detection. Tested with WB in Human,Mouse,Rat.
Gene Name: ATP-binding cassette, sub-family A (ABC1), member 4
Protein Name: Retinal-specific ATP-binding cassette transporter - Purification
- Immunogen affinity purified.
- Immunogen
- A synthetic peptide corresponding to a sequence at the C-terminus of human ABCA4 (1890-1927aa FLLTLLVQRHFFLSQWIAEPTKEPIVDEDDDVAEERQR), different from the related mouse sequence by eight amino acids.
- Isotype
- IgG
- Top Product
- Discover our top product ABCA4 Primary Antibody
-
-
- Application Notes
-
WB: Concentration: 0.1-0.5 μg/mL, Tested Species: Mouse, Rat, Predicted Species: Human
Notes: Tested Species: Species with positive results. Predicted Species: Species predicted to be fit for the product based on sequence similarities.
Other applications have not been tested. Optimal dilutions should be determined by end users. - Comment
-
Antibody can be supported by chemiluminescence kit ABIN921124 in WB.
- Restrictions
- For Research Use only
-
- Format
- Lyophilized
- Reconstitution
- Add 0.2 mL of distilled water will yield a concentration of 500 μg/mL.
- Concentration
- 500 μg/mL
- Buffer
- Each vial contains 5 mg BSA, 0.9 mg NaCl, 0.2 mg Na2HPO4, 0.05 mg Sodium azide.
- Preservative
- Sodium azide
- Precaution of Use
- This product contains Sodium azide: a POISONOUS AND HAZARDOUS SUBSTANCE which should be handled by trained staff only.
- Storage
- 4 °C,-20 °C
- Storage Comment
-
At -20°C for one year. After reconstitution, at 4°C for one month.
It can also be aliquotted and stored frozen at -20 °C for a longer time. Avoid repeated freezing and thawing.
-
- Target
- ABCA4 (ATP-Binding Cassette, Sub-Family A (ABC1), Member 4 (ABCA4))
- Alternative Name
- ABCA4 (ABCA4 Products)
- Synonyms
- ABC10 antibody, ABCR antibody, ARMD2 antibody, CORD3 antibody, FFM antibody, RMP antibody, RP19 antibody, STGD antibody, STGD1 antibody, AW050280 antibody, Abc10 antibody, Abcr antibody, D430003I15Rik antibody, RmP antibody, abcr antibody, ffm antibody, rmp antibody, rp19 antibody, stgd antibody, abc10 antibody, armd2 antibody, cord3 antibody, stgd1 antibody, zgc:91823 antibody, ATP binding cassette subfamily A member 4 antibody, ATP-binding cassette, sub-family A (ABC1), member 4 antibody, ATP binding cassette subfamily A member 4 L homeolog antibody, ATP-binding cassette, sub-family A (ABC1), member 4a antibody, ABCA4 antibody, Abca4 antibody, abca4 antibody, abca4.L antibody, abca4a antibody
- Background
-
ABCA4 (ATP-Binding Cassette, Subfamily A, Member 4), also known as ABCR, is a protein which in humans is encoded by the ABCA4 gene. ABCA4 is a member of the ATP-binding cassette transporter gene sub-family A (ABC1) found exclusively in multicellular eukaryotes. Using a whole genome radiation hybrid panel, this gene is mapped to 1p21-p13. And this gene is expressed exclusively in retina photoreceptor cells, indicating the gene product mediates transport of an essental molecule across the photoreceptor cell membrane. Additionally, it is showed by immunofluorescence microscopy and Western blot analysis that ABCR is present in foveal and peripheral cone, as well as rod, photoreceptors. The results suggested that the loss in central vision experienced by patients with Stargardt macular dystrophy arises directly from ABCR-mediated foveal cone degeneration.
Synonyms: ABCA 4 | ABCA4 | ABCR | ARMD 2 | ARMD2 | ATP binding cassette 10 | CORD3 | FFM | P78363 | Photoreceptor rim protein | RIM ABC transporter | RIM protein | RmP | RP19 | Stargardt disease protein | STGD | STGD1 - Gene ID
- 24
- UniProt
- P78363
-