SCN8A antibody (Middle Region)
-
- Target See all SCN8A Antibodies
- SCN8A (Sodium Channel, Voltage-Gated, Type VIII, alpha (SCN8A))
-
Binding Specificity
- Middle Region
-
Reactivity
- Human, Mouse, Rat
-
Host
- Rabbit
-
Clonality
- Polyclonal
-
Conjugate
- This SCN8A antibody is un-conjugated
-
Application
- Western Blotting (WB)
- Specificity
- SCN8 A antibody was raised against the middle region of SCN8
- Purification
- Affinity purified
- Immunogen
- SCN8 A antibody was raised using the middle region of SCN8 corresponding to a region with amino acids ESDPEGSKDKLDDTSSSEGSTIDIKPEVEEVPVEQPEEYLDPDACFTEGC
- Top Product
- Discover our top product SCN8A Primary Antibody
-
-
- Application Notes
-
WB: 1 µg/mL
Optimal conditions should be determined by the investigator. - Comment
-
SCN8A Blocking Peptide, catalog no. 33R-2720, is also available for use as a blocking control in assays to test for specificity of this SCN8A antibody
- Restrictions
- For Research Use only
-
- Format
- Lyophilized
- Reconstitution
- Lyophilized powder. Add distilled water for a 1 mg/mL concentration of SCN0 antibody in PBS
- Concentration
- Lot specific
- Buffer
- PBS
- Handling Advice
-
Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use. - Storage
- 4 °C/-20 °C
- Storage Comment
- Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.
-
- Target
- SCN8A (Sodium Channel, Voltage-Gated, Type VIII, alpha (SCN8A))
- Alternative Name
- SCN8A (SCN8A Products)
- Synonyms
- CERIII antibody, CIAT antibody, EIEE13 antibody, MED antibody, NaCh6 antibody, Nav1.6 antibody, PN4 antibody, AI853486 antibody, C630029C19Rik antibody, dmu antibody, med antibody, mnd-2 antibody, mnd2 antibody, nmf2 antibody, nmf335 antibody, nmf58 antibody, nur14 antibody, seal antibody, sodium voltage-gated channel alpha subunit 8 antibody, sodium channel, voltage-gated, type VIII, alpha antibody, SCN8A antibody, Scn8a antibody
- Background
- Voltage-dependent sodium channels, such as SCN8A, are responsible for the initial membrane depolarization that occurs during generation of action potentials in most electrically excitable cells.
- Molecular Weight
- 225 kDa (MW of target protein)
- Pathways
- Sensory Perception of Sound
-