You are viewing an incomplete version of our website. Please click to reload the website as full version.

anti-Human TNFRSF11A antibody for Immunohistochemistry (Paraffin-embedded Sections)

Recommended TNFRSF11A Antibody (supplied by: Log in to see )

Antigen
Tumor Necrosis Factor Receptor Superfamily, Member 11a, NFKB Activator (TNFRSF11A) Antibodies
  • CD265
  • FEO
  • LOH18CR1
  • Ly109
  • mRANK
  • ODFR
  • OFE
  • OPTB7
  • OSTS
  • PDB2
  • Rank
  • RANK
  • RGD1563614
  • TNFRSF11A
  • TRANCE-R
  • TRANCER
Reactivity
Human
101
71
39
Host
Rabbit
60
49
9
Clonality
Polyclonal
Conjugate
This TNFRSF11A antibody is un-conjugated
9
6
4
4
3
3
2
2
2
2
2
2
2
2
2
2
2
2
1
1
1
1
1
1
1
Application
Immunocytochemistry (ICC), Immunofluorescence (IF), Immunohistochemistry (IHC), Immunohistochemistry (Paraffin-embedded Sections) (IHC (p)), Western Blotting (WB)
75
50
38
28
23
23
11
5
3
3
2
Supplier
Log in to see
Supplier Product No.
Log in to see
Request

Get this product for free

It's quick and easy to submit your validation proposal. I want to validate this product

Learn more

Available images

Catalog No. ABIN4349302
Contact our Customer Service for availability and price in your country.
Relevance Score ABIN Application Conjugate Host Isotype Epitope Supplier Clonality References Details
0.0008919152 ABIN252472 FACS IHC (p) IHC WB Mouse IgG1 kappa AA 326-616, AA 330-427 Log in to see 9A725 12
0.0008919152 ABIN252036 FACS IHC (p) IHC WB PE Mouse IgG1 kappa AA 326-616, AA 330-427 Log in to see 9A725 10
0.0008919152 ABIN372451 IHC (p) WB Rabbit IgG AA 603-613 Log in to see Polyclonal
0.0008919152 ABIN3042604 IHC (p) WB Rabbit IgG AA 29-44, N-Term Log in to see Polyclonal
0.0008919152 ABIN749258 IF (p) IHC (p) WB Rabbit IgG AA 60-110 Log in to see Polyclonal
0.0008919152 ABIN1860401 ICC IHC (fro) IHC (p) ELISA WB Rabbit IgG AA 330-615 Log in to see Polyclonal
0.0008919152 ABIN749267 IHC (p) WB HRP Rabbit IgG AA 60-110 Log in to see Polyclonal
0.0008919152 ABIN749260 IHC (p) WB Biotin Rabbit IgG AA 60-110 Log in to see Polyclonal
0.0008919152 ABIN4349301 FACS IHC IHC (p) WB Mouse IgG1 kappa AA 326-616, AA 330-427 Log in to see 9A725
0.0008919152 ABIN4349305 FACS IHC IHC (p) WB Allophycocyanin Mouse IgG1 kappa AA 326-616, AA 330-427 Log in to see 9A725
0.0008919152 ABIN4349309 FACS IHC IHC (p) WB DyLight 488 Mouse IgG1 kappa AA 326-616, AA 330-427 Log in to see 9A725
0.0008919152 ABIN4349306 FACS IHC IHC (p) WB Biotin Mouse IgG1 kappa AA 326-616, AA 330-427 Log in to see 9A725
0.0008919152 ABIN4349308 FACS IHC IHC (p) WB DyLight 680 Mouse IgG1 kappa AA 326-616, AA 330-427 Log in to see 9A725
0.0008919152 ABIN4349307 FACS IHC IHC (p) WB DyLight 650 Mouse IgG1 kappa AA 326-616, AA 330-427 Log in to see 9A725
0.0008919152 ABIN4349311 FACS IHC IHC (p) WB DyLight 755 Mouse IgG1 kappa AA 326-616, AA 330-427 Log in to see 9A725
0.0008919152 ABIN4349312 FACS IHC IHC (p) WB PerCP Mouse IgG1 kappa AA 326-616, AA 330-427 Log in to see 9A725
0.0008919152 ABIN4349313 FACS IHC IHC (p) WB DyLight 550 Mouse IgG1 kappa AA 326-616, AA 330-427 Log in to see 9A725
0.0008919152 ABIN4349315 FACS IHC IHC (p) WB DyLight 405 Mouse IgG1 kappa AA 326-616, AA 330-427 Log in to see 9A725
0.0008919152 ABIN4349316 FACS IHC IHC (p) WB DyLight 405LS Mouse IgG1 kappa AA 326-616, AA 330-427 Log in to see 9A725
0.0008919152 ABIN4349314 FACS IHC IHC (p) WB DyLight 350 Mouse IgG1 kappa AA 326-616, AA 330-427 Log in to see 9A725

Top referenced anti-TNFRSF11A antibody for Immunohistochemistry (Paraffin-embedded Sections)

Similar anti-TNFRSF11A Antibodies

Application / Reactivity Human
ELISA 29 Antibodies
Enzyme Immunoassay (EIA) 4 Antibodies
Flow Cytometry (FACS) 42 Antibodies
Functional Studies (Func) 2 Antibodies
Immunocytochemistry (ICC) 2 Antibodies
Immunofluorescence (IF) 1 Antibodies
Immunofluorescence (Paraffin-embedded Sections) (IF (p)) 11 Antibodies
Immunohistochemistry (IHC) 24 Antibodies
Immunohistochemistry (Frozen Sections) (IHC (fro)) 1 Antibodies
Immunohistochemistry (Paraffin-embedded Sections) (IHC (p)) 27 Antibodies
Immunoprecipitation (IP) 19 Antibodies
Western Blotting (WB) 72 Antibodies

General

Antigen Tumor Necrosis Factor Receptor Superfamily, Member 11a, NFKB Activator (TNFRSF11A) Antibodies
Reactivity Human
(101), (71), (39)
Host Rabbit
(60), (49), (9)
Clonality
Polyclonal
Conjugate This TNFRSF11A antibody is un-conjugated
(9), (6), (4), (4), (3), (3), (2), (2), (2), (2), (2), (2), (2), (2), (2), (2), (2), (2), (1), (1), (1), (1), (1), (1), (1)
Application Immunocytochemistry (ICC), Immunofluorescence (IF), Immunohistochemistry (IHC), Immunohistochemistry (Paraffin-embedded Sections) (IHC (p)), Western Blotting (WB)
(75), (50), (38), (28), (23), (23), (11), (5), (3), (3), (2)
Supplier Log in to see

Product Details anti-TNFRSF11A Antibody

Target Details TNFRSF11A Application Details Handling Images
Specificity Specificity of antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins.
Purification Immunogen affinity purified
Immunogen This antibody was developed against Recombinant Protein corresponding to amino acids:KESSGDSCVSTHTANFGQQGACEGVLLLTLEEKTFPEDMCYPDQGGVCQGTCVGGGPYAQGEDARMLSLVSKTEIEEDSFRQMPTEDEYMDRPSQPTDQLLFLTEPGSKSTPPFSEPLE
Isotype IgG

Target Details TNFRSF11A

Product Details anti-TNFRSF11A Antibody Application Details Handling Images back to top
Antigen
Alternative Name RANK/TNFRSF11A (TNFRSF11A Antibody Abstract)
Background Gene Symbol: TNFRSF11A
Pathways NF-kappaB Signaling

Application Details

Product Details anti-TNFRSF11A Antibody Target Details TNFRSF11A Handling Images back to top
Application Notes Western Blot 1:100 - 1:250, Immunohistochemistry, Immunocytochemistry/Immunofluorescence 1 - 4 μg/mL, Immunohistochemistry-Paraffin 1:500 - 1:1000
Comment

The antibodies are intended for use in vitro experiments only. Our antibodies have not been tested nor are recommended for use in vivo.

Restrictions For Research Use only

Handling

Product Details anti-TNFRSF11A Antibody Target Details TNFRSF11A Application Details Images back to top
Format Liquid
Buffer PBS, pH 7.2, containing 40 % glycerol
Buffer contains: 0.02 % Sodium Azide
Preservative Sodium azide
Precaution of Use This product contains Sodium azide: a POISONOUS AND HAZARDOUS SUBSTANCE which should be handled by trained staff only.
Storage 4 °C,-20 °C
Storage Comment Store at 4°C short term. Aliquot and store at -20°C long term. Avoid freeze-thaw cycles.

Images

Product Details anti-TNFRSF11A Antibody Target Details TNFRSF11A Application Details Handling back to top
Supplier Images
Immunofluorescence (IF) image for anti-TNFRSF11A antibody (Tumor Necrosis Factor Receptor Superfamily, Member 11a, NFKB Activator) (ABIN4349302) Immunocytochemistry/Immunofluorescence: RANK Antibody [NBP1-85771] - Immunofluorescen...
Immunohistochemistry (Paraffin-embedded Sections) (IHC (p)) image for anti-TNFRSF11A antibody (Tumor Necrosis Factor Receptor Superfamily, Member 11a, NFKB Activator) (ABIN4349302) Immunohistochemistry-Paraffin: RANK Antibody [NBP1-85771] - Staining of human cerebra...
Western Blotting (WB) image for anti-TNFRSF11A antibody (Tumor Necrosis Factor Receptor Superfamily, Member 11a, NFKB Activator) (ABIN4349302) Western Blot: RANK Antibody [NBP1-85771] - Lane 1: Marker [kDa] 230, 130, 95, 72, 56,...