You are viewing an incomplete version of our website. Please click to reload the website as full version.

anti-Human PDK4 antibody for Immunohistochemistry

Recommended PDK4 Antibody (supplied by: Log in to see )

Antigen
Pyruvate Dehydrogenase Kinase, Isozyme 4 (PDK4) Antibodies
  • AV005916
Epitope
N-Term
22
22
13
12
10
6
5
5
5
5
5
4
3
3
3
3
3
3
1
1
1
1
1
1
1
Reactivity
Cow (Bovine), Dog (Canine), Human, Mouse (Murine), Pig (Porcine), Rat (Rattus)
116
47
11
Host
Rabbit
119
19
Clonality
Polyclonal
Conjugate
This PDK4 antibody is un-conjugated
9
8
7
7
7
6
2
2
2
Application
Immunohistochemistry (IHC), Western Blotting (WB)
118
78
54
14
10
4
2
2
1
Supplier
Log in to see
Supplier Product No.
Log in to see
Request

Get this product for free

It's quick and easy to submit your validation proposal. I want to validate this product

Learn more

Available images

Catalog No. ABIN2777592
$ 289.00
Plus shipping costs $45.00
Relevance Score ABIN Application Conjugate Host Isotype Epitope Supplier Clonality References Details
0.22053991 ABIN1874085 IHC WB Rabbit IgG Log in to see Polyclonal
0.22053991 ABIN631050 IHC WB Rabbit N-Term Log in to see Polyclonal
0.22053991 ABIN2496022 IF IHC WB Rabbit Ig Fraction C-Term Log in to see Polyclonal
0.22053991 ABIN2405796 IHC WB Rabbit IgG Log in to see Polyclonal
0.22053991 ABIN2496020 IHC ELISA WB Rabbit Ig Fraction Log in to see Polyclonal
0.22053991 ABIN2496021 IHC ELISA WB Rabbit Ig Fraction Log in to see Polyclonal
0.22053991 ABIN2431767 IHC ELISA WB Rabbit IgG Log in to see Polyclonal
0.22053991 ABIN3017310 IHC WB Rabbit Log in to see Polyclonal
0.0011363331 ABIN2460574 IHC ELISA WB Rabbit Log in to see Polyclonal
0.0011363331 ABIN1922669 IHC ELISA WB Alkaline Phosphatase (AP) Rabbit IgG C-Term, AA 382-411 Log in to see Polyclonal
0.0011363331 ABIN1922672 IHC ELISA WB PE Rabbit IgG C-Term, AA 382-411 Log in to see Polyclonal
0.0011363331 ABIN1922670 IHC ELISA WB APC Rabbit IgG C-Term, AA 382-411 Log in to see Polyclonal
0.0011363331 ABIN791131 IHC WB Rabbit IgG Log in to see Polyclonal
0.0011363331 ABIN1922671 IHC ELISA WB FITC Rabbit IgG C-Term, AA 382-411 Log in to see Polyclonal
0.0011363331 ABIN1922676 IHC ELISA WB PE Rabbit IgG Internal Region Log in to see Polyclonal
0.0011363331 ABIN1922675 IHC ELISA WB FITC Rabbit IgG Internal Region Log in to see Polyclonal
0.0011363331 ABIN1922674 IHC ELISA WB Alkaline Phosphatase (AP) Rabbit IgG Internal Region Log in to see Polyclonal
0.0011363331 ABIN1922673 IHC ELISA WB APC Rabbit IgG Internal Region Log in to see Polyclonal
0.0011363331 ABIN2880497 IHC Rabbit IgG Log in to see Polyclonal
0.0011363331 ABIN2895285 IHC Rabbit Log in to see Polyclonal

Top referenced anti-PDK4 antibody for Immunohistochemistry

Similar anti-PDK4 Antibodies

Application / Reactivity Human Mouse (Murine) Cow (Bovine) Dog (Canine) Pig (Porcine) Rat (Rattus)
Western Blotting (WB) 103 Antibodies 41 Antibodies 5 Antibodies 1 Antibodies 1 Antibodies 10 Antibodies
Immunohistochemistry (Paraffin-embedded Sections) (IHC (p)) 13 Antibodies 4 Antibodies
Immunohistochemistry (IHC) 1 Antibodies 1 Antibodies 55 Antibodies 15 Antibodies 1 Antibodies 8 Antibodies
Immunohistochemistry (Frozen Sections) (IHC (fro)) 1 Antibodies 1 Antibodies

General

Antigen Pyruvate Dehydrogenase Kinase, Isozyme 4 (PDK4) Antibodies
Epitope N-Term
(22), (22), (13), (12), (10), (6), (5), (5), (5), (5), (5), (4), (3), (3), (3), (3), (3), (3), (1), (1), (1), (1), (1), (1), (1)
Reactivity Cow (Bovine), Dog (Canine), Human, Mouse (Murine), Pig (Porcine), Rat (Rattus)
(116), (47), (11)
Host Rabbit
(119), (19)
Clonality
Polyclonal
Conjugate This PDK4 antibody is un-conjugated
(9), (8), (7), (7), (7), (6), (2), (2), (2)
Application Immunohistochemistry (IHC), Western Blotting (WB)
(118), (78), (54), (14), (10), (4), (2), (2), (1)
Pubmed 2 references available
Supplier Log in to see

Product Details anti-PDK4 Antibody

Target Details PDK4 Application Details Handling References for anti-PDK4 Antibody (ABIN2777592) Images
Blocking Peptide Blocking peptide for this product available: ABIN981542
Sequence MKAARFVLRSAGSLNGAGLVPREVEHFSRYSPSPLSMKQL LDFGSENACE
Predicted Reactivity Horse : 100 %, Human : 100 %, Pig : 100 %, Rabbit : 100 %, Bovine : 90 %, Guinea pig : 90 %, Mouse : 90 %, Rat : 90 %, Dog : 90 %, Chicken : 80 %
Characteristics This is a rabbit polyclonal antibody against PDK4. It was validated on Western Blot and immunohistochemistry.
Purification Affinity Purified
Immunogen The immunogen is a synthetic peptide directed towards the N terminal region of human PDK4

Target Details PDK4

Product Details anti-PDK4 Antibody Application Details Handling References for anti-PDK4 Antibody (ABIN2777592) Images back to top
Antigen
Alternative Name PDK4 (PDK4 Antibody Abstract)
Background PDK4 is a member of the PDK/BCKDK protein kinase family and is a mitochondrial protein with a histidine kinase domain. This protein is located in the matrix of the mitrochondria and inhibits the pyruvate dehydrogenase complex by phosphorylating one of its subunits, thereby contributing to the regulation of glucose metabolism.This gene is a member of the PDK/BCKDK protein kinase family and encodes a mitochondrial protein with a histidine kinase domain. This protein is located in the matrix of the mitrochondria and inhibits the pyruvate dehydrogenase complex by phosphorylating one of its subunits, thereby contributing to the regulation of glucose metabolism. Expression of this gene is regulated by glucocorticoids, retinoic acid and insulin.
Molecular Weight 46 kDa
Gene ID 5166
NCBI Accession NP_002603, NM_002612
UniProt Q16654
Research Area Signaling, Metabolism
Pathways PI3K-Akt Signaling, Hedgehog Signaling

Application Details

Product Details anti-PDK4 Antibody Target Details PDK4 Handling References for anti-PDK4 Antibody (ABIN2777592) Images back to top
Application Notes Optimal working dilutions should be determined experimentally by the investigator.
Comment

Antigen size: 411 AA

Restrictions For Research Use only

Handling

Product Details anti-PDK4 Antibody Target Details PDK4 Application Details References for anti-PDK4 Antibody (ABIN2777592) Images back to top
Format Liquid
Reconstitution Add 50 µL of distilled water.
Concentration 1 mg/mL
Buffer PBS buffer with 2 % sucrose
Handling Advice Avoid repeated freeze-thaw cycles.
Storage 4 °C,-20 °C
Storage Comment For short term use, store at 2-8 °C up to 1 week. For long term storage, store at -20 °C in small aliquots to prevent freeze-thaw cycles.

References for anti-PDK4 Antibody (ABIN2777592)

Product Details anti-PDK4 Antibody Target Details PDK4 Application Details Handling Images back to top
Product cited in:

Lazrek, Goffard, Schanen, Karquel, Bocket, Lion, Devaux, Hedouin, Gosset, Hober: "Detection of hepatitis C virus antibodies and RNA among medicolegal autopsy cases in Northern France." in: Diagnostic microbiology and infectious disease, Vol. 55, Issue 1, pp. 55-8, 2006

Background publications

Kimura, Wakamatsu, Suzuki, Ota, Nishikawa, Yamashita, Yamamoto, Sekine, Tsuritani, Wakaguri, Ishii, Sugiyama, Saito, Isono, Irie, Kushida, Yoneyama, Otsuka, Kanda, Yokoi, Kondo, Wagatsuma, Murakawa et al.: "Diversification of transcriptional modulation: large-scale identification and characterization of putative alternative promoters of human genes. ..." in: Genome research, Vol. 16, Issue 1, pp. 55-65, 2006

Images

Product Details anti-PDK4 Antibody Target Details PDK4 Application Details Handling References for anti-PDK4 Antibody (ABIN2777592) back to top
Supplier Images
Western Blotting (WB) image for anti-PDK4 antibody (Pyruvate Dehydrogenase Kinase, Isozyme 4) (N-Term) (ABIN2777592) WB Suggested Anti-PDK4 Antibody Titration: 0.2-1 ug/ml
Positive Control:...
Western Blotting (WB) image for anti-PDK4 antibody (Pyruvate Dehydrogenase Kinase, Isozyme 4) (N-Term) (ABIN2777592) Sample Type: Huh7 HepG2 (50ug)
Primary Antibody Dilution: 1:500
...
Immunohistochemistry (IHC) image for anti-PDK4 antibody (Pyruvate Dehydrogenase Kinase, Isozyme 4) (N-Term) (ABIN2777592) anti-Pyruvate Dehydrogenase Kinase, Isozyme 4 (PDK4) (N-Term) antibody (Image 3)
Western Blotting (WB) image for anti-PDK4 antibody (Pyruvate Dehydrogenase Kinase, Isozyme 4) (N-Term) (ABIN2777592) WB Suggested Anti-PDK4
Antibody Titration: 0.2-1 µg/mL
Positive Control...