RUNX1 antibody (AA 200-233)

Catalog No. ABIN2616047

Product Details anti-RUNX1 Antibody

Target: RUNX1 (Runt-Related Transcription Factor 1 (RUNX1))

Binding Specificity: AA 200-233

Reactivity: Human, Mouse, Rat, Cow, Horse, Monkey, Chimpanzee, Hamster, Orang-Utan

Host: Rabbit

Clonality: Polyclonal

Conjugate: This RUNX1 antibody is un-conjugated

Application: Western Blotting (WB), Immunohistochemistry (IHC), Immunohistochemistry (Paraffin-embedded Sections) (IHC (p))

Specificity: Expressed in all tissues examined except brain and heart. Highest levels in thymus, bone marrow and peripheral blood.

Purification: Immunogen affinity purified

Immunogen: A synthetic peptide corresponding to a sequence in the middle region of human RUNX1(200-233aa ELEQLRRTAMRVSPHHPAPTPNPRASLNHSTAFN), identical to the related mouse and rat sequences.

Isotype: IgG

Application Details

Application Notes: Optimal working dilution should be determined by the investigator.

Comment:

Target Species of Antibody: Human

Restrictions: For Research Use only

Handling

Format: Liquid

Reconstitution: Distilled water

Concentration: Lot specific

Buffer: Contains 5 mg BSA, 0.9 mg NaCl, 0.2 mg Na2 HPO4, 0.05 mg Thimerosal, 0.05 mg sodium azide per 100 μg antibody.

Preservative: Sodium azide, Thimerosal (Merthiolate)

Precaution of Use: This product contains Sodium azide and Thimerosal (Merthiolate): POISONOUS AND HAZARDOUS SUBSTANCES which should be handled by trained staff only.

Handling Advice: Avoid freeze-thaw cycles.

Storage: 4 °C,-20 °C

Storage Comment: At -20°C for 1 year. After reconstitution, at 4°C for 1 month. It can also be aliquotted and stored frozen at -20°C for a longer time.Avoid freeze-thaw cycles.

Target Details for RUNX1

Target: RUNX1 (Runt-Related Transcription Factor 1 (RUNX1))

Alternative Name: AML1 / RUNX1 (RUNX1 Products)

Synonyms: RUNX1 antibody, runx1 antibody, AI462102 antibody, AML1 antibody, Cbfa2 antibody, Pebp2a2 antibody, Pebpa2b antibody, AML1-EVI-1 antibody, AMLCR1 antibody, CBFA2 antibody, EVI-1 antibody, PEBP2aB antibody, runxa antibody, Runx-1 antibody, XAML antibody, Xaml1 antibody, aml antibody, aml-1 antibody, aml1 antibody, aml1-evi-1 antibody, amlcr1 antibody, cbfa2 antibody, evi-1 antibody, pebp2ab antibody, Aml1 antibody, uncharacterized LOC473981 antibody, runt-related transcription factor antibody, runt related transcription factor 1 antibody, runt-related transcription factor 1 antibody, runt related transcription factor 1 L homeolog antibody, LOC473981 antibody, runt antibody, Runx1 antibody, RUNX1 antibody, runx1 antibody, runx1.L antibody

Background: Name/Gene ID: RUNX1

Synonyms: RUNX1, AMLCR1, Aml1 oncogene, AML1, AML1-EVI-1, CBF-alpha-2, CBFA2, Acute myeloid leukemia 1, EVI-1, PEBP2A2, PEA2-alpha B, AML1-EVI-1 fusion protein, Oncogene AML-1, PEBP2-alpha B, PEBP2aB

Gene ID: 861