ABCB1 antibody (AA 621-650)

Catalog No. ABIN2738047

Product Details anti-ABCB1 Antibody

Target: ABCB1 (ATP-Binding Cassette, Sub-Family B (MDR/TAP), Member 1 (ABCB1))

Binding Specificity: AA 621-650

Reactivity: Human, Mouse, Rat, Chimpanzee

Host: Rabbit

Clonality: Polyclonal

Conjugate: This ABCB1 antibody is un-conjugated

Application: Immunohistochemistry (IHC), Immunohistochemistry (Paraffin-embedded Sections) (IHC (p)), Immunohistochemistry (Frozen Sections) (IHC (fro))

Specificity: Expressed in liver, kidney, small intestine and brain.

Purification: Immunogen affinity purified

Immunogen: A synthetic peptide corresponding to a sequence in the middle region of human P Glycoprotein(621-650aa IYFKLVTMQTAGNEVELENAADESKSEIDA), different from the related rat sequence by twelve amino acids.

Isotype: IgG

Application Details

Application Notes: Optimal working dilution should be determined by the investigator.

Comment:

Target Species of Antibody: Human

Restrictions: For Research Use only

Handling

Format: Lyophilized

Reconstitution: Distilled water

Concentration: Lot specific

Buffer: Lyophilized from 5 mg BSA, 0.9 mg sodium chloride, 0.2 mg sodium phosphate, 0.05 mg Thimerosal, 0.05 mg sodium azide

Preservative: Sodium azide, Thimerosal (Merthiolate)

Precaution of Use: This product contains Sodium azide and Thimerosal (Merthiolate): POISONOUS AND HAZARDOUS SUBSTANCES which should be handled by trained staff only.

Handling Advice: avoid freeze thaw cycles

Storage: 4 °C,-20 °C

Storage Comment: At -20°C for 1 year. After reconstitution, at 4°C for 1 month. It can also be aliquotted and stored frozen at -20°C for a longer time.Avoid freeze-thaw cycles.

Target Details for ABCB1

Target: ABCB1 (ATP-Binding Cassette, Sub-Family B (MDR/TAP), Member 1 (ABCB1))

Alternative Name: ABCB1 / MDR1 / P Glycoprotein (ABCB1 Products)

Synonyms: ABC20 antibody, CD243 antibody, CLCS antibody, GP170 antibody, MDR1 antibody, P-GP antibody, PGY1 antibody, Abcb1 antibody, Mdr1a antibody, p-gp antibody, xemdr antibody, Mdr1 antibody, Mdr1b antibody, Pgy-1 antibody, Pgy1 antibody, mdr antibody, ABCB1 antibody, PGP1 antibody, ATP binding cassette subfamily B member 1 antibody, ATP binding cassette subfamily B member 1A antibody, ATP binding cassette subfamily B member 1 L homeolog antibody, ATP-binding cassette, sub-family B (MDR/TAP), member 1B antibody, ABCB1 antibody, Abcb1a antibody, abcb1.L antibody, Abcb1b antibody, Abcb1 antibody

Background: Name/Gene ID: ABCB1
Subfamily: ATP-binding cassette - ABCB/MDR
Family: Transporter

Synonyms: ABCB1, ABC20, Abcb1b, CLCS, Colchicin sensitivity, CD243, Doxorubicin resistance, IBD13, gp170, MDR1, Multidrug resistance protein 1, P glycoprotein, P-glycoprotein 1, P-GP, CD243 antigen, PGY1

Gene ID: 5243