ATP2A3 antibody (AA 1-30)

Catalog No. ABIN2738412

Product Details anti-ATP2A3 Antibody

Target: ATP2A3 (ATPase, Ca++ Transporting, Ubiquitous (ATP2A3))

Binding Specificity: AA 1-30

Reactivity: Human, Mouse, Rat, Rabbit

Host: Rabbit

Clonality: Polyclonal

Conjugate: This ATP2A3 antibody is un-conjugated

Application: Western Blotting (WB), Immunohistochemistry (IHC), Immunohistochemistry (Paraffin-embedded Sections) (IHC (p))

Specificity: Found in most tissues. Most abundant in thymus, trachea, salivary gland, spleen, bone marrow, lymph node, peripheral leukocytes, pancreas and colon. Also detected in fetal tissues. Expressed in cell lineages of hematopoietic, epithelial, or embryonic origin and also expressed in several cancer cell lines. .

Purification: Immunogen affinity purified

Immunogen: A synthetic peptide corresponding to a sequence at the N-terminus of human ATP2A3(1-30aa MEAAHLLPAADVLRHFSVTAEGGLSPAQVT), different from the related mouse sequence by five amino acids, and from the related rat sequence by six amino acids.

Isotype: IgG

Application Details

Application Notes: Optimal working dilution should be determined by the investigator.

Comment:

Target Species of Antibody: Human

Restrictions: For Research Use only

Handling

Format: Lyophilized

Reconstitution: Distilled water

Concentration: Lot specific

Buffer: Lyophilized from 5 mg BSA, 0.9 mg sodium chloride, 0.2 mg sodium phosphate, 0.05 mg sodium azide

Preservative: Sodium azide

Precaution of Use: This product contains Sodium azide: a POISONOUS AND HAZARDOUS SUBSTANCE which should be handled by trained staff only.

Handling Advice: avoid freeze thaw cycles

Storage: 4 °C,-20 °C

Storage Comment: At -20°C for 1 year. After reconstitution, at 4°C for 1 month. It can also be aliquotted and stored frozen at -20°C for a longer time.Avoid freeze-thaw cycles.

Target Details for ATP2A3

Target: ATP2A3 (ATPase, Ca++ Transporting, Ubiquitous (ATP2A3))

Alternative Name: ATP2A3 / SERCA3 (ATP2A3 Products)

Synonyms: serca3 antibody, si:dkey-205l20.1 antibody, ATP2A3 antibody, Atp2a3 antibody, SERCA3 antibody, SERCA3b antibody, Serca3 antibody, SERCA antibody, ATPase sarcoplasmic/endoplasmic reticulum Ca2+ transporting 3 L homeolog antibody, ATPase, Ca++ transporting, ubiquitous antibody, ATPase sarcoplasmic/endoplasmic reticulum Ca2+ transporting 3 antibody, atp2a3.L antibody, atp2a3 antibody, ATP2A3 antibody, Atp2a3 antibody

Background: Name/Gene ID: ATP2A3
Subfamily: ATPase - P type, type IIA
Family: Transporter

Synonyms: ATP2A3, Calcium pump 3, SERCA3, SR Ca(2+)-ATPase 3, SERCA3b

Gene ID: 489

Pathways: Myometrial Relaxation and Contraction, Ribonucleoside Biosynthetic Process