OTX2 antibody (AA 258-289)

Catalog No. ABIN2743418

Product Details anti-OTX2 Antibody

Target: OTX2 (Orthodenticle Homeobox 2 (OTX2))

Binding Specificity: AA 258-289

Reactivity: Human, Rat, Mouse, Rabbit, Cow, Sheep, Dog, Horse, Pig, Bat, Hamster, Xenopus laevis, Chicken, Chimpanzee, Gibbon, Monkey, Orang-Utan

Host: Rabbit

Clonality: Polyclonal

Conjugate: This OTX2 antibody is un-conjugated

Application: Western Blotting (WB)

Specificity: Expressed in brain.

Purification: Immunogen affinity purified

Immunogen: A synthetic peptide corresponding to a sequence at the C-terminus of human Otx2 (258-289aa DYKDQTASWKLNFNADCLDYKDQTSSWKFQVL), identical to the related mouse sequence.

Isotype: IgG

Application Details

Application Notes: Optimal working dilution should be determined by the investigator.

Comment:

Target Species of Antibody: Human

Restrictions: For Research Use only

Handling

Format: Lyophilized

Reconstitution: Distilled water

Concentration: Lot specific

Buffer: Lyophilized from 5 mg BSA, 0.9 mg sodium chloride, 0.2 mg sodium phosphate, 0.05 mg sodium azide

Preservative: Sodium azide

Precaution of Use: This product contains Sodium azide: a POISONOUS AND HAZARDOUS SUBSTANCE which should be handled by trained staff only.

Handling Advice: avoid freeze thaw cycles

Storage: 4 °C,-20 °C

Storage Comment: At -20°C for 1 year. After reconstitution, at 4°C for 1 month. It can also be aliquotted and stored frozen at -20°C for a longer time.Avoid freeze-thaw cycles.

Target Details for OTX2

Target: OTX2 (Orthodenticle Homeobox 2 (OTX2))

Alternative Name: OTX2 (OTX2 Products)

Synonyms: CPHD6 antibody, MCOPS5 antibody, E130306E05Rik antibody, id:ibd2915 antibody, zOtx2 antibody, zgc:136535 antibody, zotx-2 antibody, Xotx-2 antibody, Xotx2 antibody, otx-2 antibody, otx2 antibody, orthodenticle homeobox 2 antibody, orthodenticle homeobox 2 S homeolog antibody, orthodenticle homeobox 2 L homeolog antibody, OTX2 antibody, Otx2 antibody, otx2 antibody, otx2.S antibody, otx2.L antibody

Background: Name/Gene ID: OTX2

Synonyms: OTX2, CPHD6, Homeobox protein OTX2, MCOPS5, Orthodenticle homeobox 2, Orthodenticle homolog 2

Gene ID: 5015

Pathways: Dopaminergic Neurogenesis