OTX2 antibody (C-Term)

Catalog No. ABIN3032102

Product Details anti-OTX2 Antibody

Target: OTX2 (Orthodenticle Homeobox 2 (OTX2))

Binding Specificity: C-Term

Reactivity: Human

Host: Rabbit

Clonality: Polyclonal

Conjugate: This OTX2 antibody is un-conjugated

Application: Western Blotting (WB)

Purification: Antigen affinity

Immunogen: An amino acid sequence from the C-terminus of human Orthodenticle homeobox 2 (DYKDQTASWKLNFNADCLDYKDQTSSWKFQVL) was used as the immunogen for this Otx2 antibody (100% mouse homology).

Isotype: IgG

Application Details

Application Notes: The stated application concentrations are suggested starting amounts. Titration of the Otx2 antibody may be required due to differences in protocols and secondary/substrate sensitivity.\. Western blot: 0.5-1 μg/mL

Restrictions: For Research Use only

Handling

Buffer: 0.5 mg/mL if reconstituted with 0.2 mL sterile DI water

Storage: -20 °C

Storage Comment: After reconstitution, the Otx2 antibody can be stored for up to one month at 4°C. For long-term, aliquot and store at -20°C. Avoid repeated freezing and thawing.

Target Details for OTX2

Target: OTX2 (Orthodenticle Homeobox 2 (OTX2))

Alternative Name: Otx2 (OTX2 Products)

Synonyms: CPHD6 antibody, MCOPS5 antibody, E130306E05Rik antibody, id:ibd2915 antibody, zOtx2 antibody, zgc:136535 antibody, zotx-2 antibody, Xotx-2 antibody, Xotx2 antibody, otx-2 antibody, otx2 antibody, orthodenticle homeobox 2 antibody, orthodenticle homeobox 2 S homeolog antibody, orthodenticle homeobox 2 L homeolog antibody, OTX2 antibody, Otx2 antibody, otx2 antibody, otx2.S antibody, otx2.L antibody

Background: Orthodenticle homeobox 2 is also known as CPHD6 or MCOPS5. The OTX2 gene encodes a member of the bicoid subfamily of homeodomain-containing transcription factors. Otx2 acts as a transcription factor and plays a role in brain, craniofacial, and sensory organ development. The encoded protein also influences the proliferation and differentiation of dopaminergic neuronal progenitor cells during mitosis. Mutations in this gene cause syndromic microphthalmia 5 (MCOPS5) and combined pituitary hormone deficiency 6 (CPHD6). Otx2 is also suspected of having an oncogenic role in medulloblastoma. Alternative splicing results in multiple transcript variants encoding distinct isoforms. Pseudogenes of this gene are known to exist on chromosomes two and nine.

Gene ID: 5015

Pathways: Dopaminergic Neurogenesis