PIM1 antibody (C-Term)

Catalog No. ABIN3032233

Product Details anti-PIM1 Antibody

Target: PIM1 (Pim-1 Oncogene (PIM1))

Binding Specificity: C-Term

Reactivity: Human

Host: Rabbit

Clonality: Polyclonal

Conjugate: This PIM1 antibody is un-conjugated

Application: Western Blotting (WB)

Purification: Antigen affinity

Immunogen: An amino acid sequence from the C-terminus of human PIM1 (EEIQNHPWMQDVLLPQETAEIHLHSLSPGPSK) was used as the immunogen for this PIM-1 antibody.

Isotype: IgG

Application Details

Application Notes: The stated application concentrations are suggested starting amounts. Titration of the PIM-1 antibody may be required due to differences in protocols and secondary/substrate sensitivity.\. Western blot: 0.5-1 μg/mL

Restrictions: For Research Use only

Handling

Buffer: 0.5 mg/mL if reconstituted with 0.2 mL sterile DI water

Storage: -20 °C

Storage Comment: After reconstitution, the PIM-1 antibody can be stored for up to one month at 4°C. For long-term, aliquot and store at -20°C. Avoid repeated freezing and thawing.

Target Details for PIM1

Target: PIM1 (Pim-1 Oncogene (PIM1))

Alternative Name: PIM-1 (PIM1 Products)

Synonyms: PIM antibody, Pim-1 antibody, PIM1 antibody, pim antibody, pim-1 antibody, pim3 antibody, Pim-1 proto-oncogene, serine/threonine kinase antibody, proviral integration site 1 antibody, Pim-1 proto-oncogene, serine/threonine kinase L homeolog antibody, PIM1 antibody, Pim1 antibody, pim1 antibody, pim1.L antibody

Background: Proto-oncogene serine/threonine-protein kinase PIM-1 is an enzyme that in humans is encoded by the PIM1 gene. It is mapped to 6p21.2. Primarily expressed in spleen, thymus, bone marrow, prostate, oral epithelial, hippocampus and fetal liver cells, It has also been found to be highly expressed in cell cultures isolated from human tumors. PIM-1 is mainly involved in cell cycle progression, apoptosis and transcriptional activation, as well as more general signal transduction pathways. It has been found a physiologic role of the PIM-1 oncogene during hematopoietic development and a deregulation of the gene in various leukemias. It also has a role in cardioprotection downstream of AKT activation.

Gene ID: 5292

Pathways: Glycosaminoglycan Metabolic Process