MLH1 antibody (C-Term)

Catalog No. ABIN3043404

Product Details anti-MLH1 Antibody

Target: MLH1 (MutL Homolog 1 (MLH1))

Binding Specificity: AA 722-756, C-Term

Reactivity: Human, Mouse, Rat

Host: Rabbit

Clonality: Polyclonal

Conjugate: This MLH1 antibody is un-conjugated

Application: Western Blotting (WB)

Purpose: Rabbit IgG polyclonal antibody for DNA mismatch repair protein Mlh1(MLH1) detection. Tested with WB in Human,Mouse,Rat.

Sequence: KALRSHILPP KHFTEDGNIL QLANLPDLYK VFERC

Cross-Reactivity (Details): No cross reactivity with other proteins.

Characteristics: Rabbit IgG polyclonal antibody for DNA mismatch repair protein Mlh1(MLH1) detection. Tested with WB in Human,Mouse,Rat.
Gene Name: mutL homolog 1
Protein Name: DNA mismatch repair protein Mlh1

Purification: Immunogen affinity purified.

Immunogen: A synthetic peptide corresponding to a sequence at the C-terminus of human MLH1 (722-756aa KALRSHILPPKHFTEDGNILQLANLPDLYKVFERC), different from the related mouse sequence by three amino acids, and from the related rat sequence by four amino acids.

Isotype: IgG

Application Details

Application Notes: WB: Concentration: 0.1-0.5 μg/mL, Tested Species: Human, Mouse, Rat
Notes: Tested Species: Species with positive results.
Other applications have not been tested. Optimal dilutions should be determined by end users.

Comment:

Antibody can be supported by chemiluminescence kit ABIN921124 in WB.

Restrictions: For Research Use only

Handling

Format: Lyophilized

Reconstitution: Add 0.2 mL of distilled water will yield a concentration of 500 μg/mL.

Concentration: 500 μg/mL

Buffer: Each vial contains 5 mg BSA, 0.9 mg NaCl, 0.2 mg Na2HPO4, 0.05 mg Sodium azide.

Preservative: Sodium azide

Precaution of Use: This product contains Sodium azide: a POISONOUS AND HAZARDOUS SUBSTANCE which should be handled by trained staff only.

Handling Advice: Avoid repeated freezing and thawing.

Storage: 4 °C/-20 °C

Storage Comment: At -20°C for one year. After reconstitution, at 4°C for one month.
It can also be aliquotted and stored frozen at -20 °C for a longer time. Avoid repeated freezing and thawing.

Target Details for MLH1

Target: MLH1 (MutL Homolog 1 (MLH1))

Alternative Name: MLH1 (MLH1 Products)

Synonyms: CG11482 antibody, Dmel\\CG11482 antibody, dmlh-1 antibody, dmlh1 antibody, zgc:66301 antibody, MLH1 antibody, LOC100232198 antibody, 1110035C23Rik antibody, AI317206 antibody, AI325952 antibody, AI561766 antibody, COCA2 antibody, FCC2 antibody, HNPCC antibody, HNPCC2 antibody, hMLH1 antibody, mutL homolog 1 antibody, CG11482 gene product from transcript CG11482-RB antibody, mutL homolog 1 S homeolog antibody, mutL homolog 1, colon cancer, nonpolyposis type 2 (E. coli) antibody, DNA mismatch repair protein Mlh1 antibody, MLH1 antibody, Mlh1 antibody, mlh1.S antibody, mlh1 antibody, LOC588545 antibody

Background: MutL homolog 1, colon cancer, nonpolyposis type 2 (E. coli) is a protein that in humans is encoded by the MLH1 gene located on Chromosome 3. This gene was identified as a locus frequently mutated in hereditary nonpolyposis colon cancer (HNPCC). It is a human homolog of the E. coli DNA mismatch repair gene mutL, consistent with the characteristic alterations in microsatellite sequences (RER+phenotype) found in HNPCC. Alternative splicing results in multiple transcript variants encoding distinct isoforms. Additional transcript variants have been described, but their full-length natures have not been determined.

Synonyms: COCA 2 antibody|COCA2 antibody|DNA mismatch repair protein Mlh1 antibody|FCC 2 antibody|FCC2 antibody|hMLH 1 antibody|hMLH1 antibody| HNPCC 2 antibody|HNPCC antibody|HNPCC2 antibody|MGC5172 antibody|MLH 1 antibody|MLH1 antibody|MLH1_HUMAN antibody|MutL homolog 1 (E. coli) antibody|MutL homolog 1 antibody|MutL homolog 1 colon cancer nonpolyposis type 2 antibody|MutL homolog 1, colon cancer, nonpolyposis type 2 (E. coli) antibody|MutL protein homolog 1 antibody|MutL, E. coli, homolog of, 1 antibody

Gene ID: 4292

UniProt: P40692

Pathways: DNA Damage Repair, Production of Molecular Mediator of Immune Response