LIFR antibody (C-Term)

Catalog No. ABIN3043410

Product Details anti-LIFR Antibody

Target: LIFR (Leukemia Inhibitory Factor Receptor alpha (LIFR))

Binding Specificity: AA 863-899, C-Term

Reactivity: Human

Host: Rabbit

Clonality: Polyclonal

Conjugate: This LIFR antibody is un-conjugated

Application: Western Blotting (WB)

Purpose: Rabbit IgG polyclonal antibody for Leukemia inhibitory factor receptor(LIFR) detection. Tested with WB in Human.

Sequence: EWIKETFYPD IPNPENCKAL QFQKSVCEGS SALKTLE

Cross-Reactivity (Details): No cross reactivity with other proteins.

Characteristics: Rabbit IgG polyclonal antibody for Leukemia inhibitory factor receptor(LIFR) detection. Tested with WB in Human.
Gene Name: leukemia inhibitory factor receptor alpha
Protein Name: Leukemia inhibitory factor receptor

Purification: Immunogen affinity purified.

Immunogen: A synthetic peptide corresponding to a sequence at the C-terminus of human LIFR(863-899aa EWIKETFYPDIPNPENCKALQFQKSVCEGSSALKTLE), different from the related mouse and rat sequences by one amino acid.

Isotype: IgG

Application Details

Application Notes: WB: Concentration: 0.1-0.5 μg/mL, Tested Species: Human
Notes: Tested Species: Species with positive results.
Other applications have not been tested. Optimal dilutions should be determined by end users.

Comment:

Antibody can be supported by chemiluminescence kit ABIN921124 in WB.

Restrictions: For Research Use only

Handling

Format: Lyophilized

Reconstitution: Add 0.2 mL of distilled water will yield a concentration of 500 μg/mL.

Concentration: 500 μg/mL

Buffer: Each vial contains 5 mg BSA, 0.9 mg NaCl, 0.2 mg Na2HPO4, 0.05 mg Sodium azide.

Preservative: Sodium azide

Precaution of Use: This product contains Sodium azide: a POISONOUS AND HAZARDOUS SUBSTANCE which should be handled by trained staff only.

Handling Advice: Avoid repeated freezing and thawing.

Storage: 4 °C/-20 °C

Storage Comment: At -20°C for one year. After reconstitution, at 4°C for one month.
It can also be aliquotted and stored frozen at -20 °C for a longer time. Avoid repeated freezing and thawing.

Target Details for LIFR

Target: LIFR (Leukemia Inhibitory Factor Receptor alpha (LIFR))

Alternative Name: LIFR (LIFR Products)

Synonyms: A230075M04Rik antibody, AW061234 antibody, LIF antibody, CD118 antibody, LIF-R antibody, SJS2 antibody, STWS antibody, SWS antibody, leukemia inhibitory factor receptor antibody, LIF receptor alpha antibody, leukemia inhibitory factor receptor alpha antibody, Lifr antibody, LOC397451 antibody, LIFR antibody

Background: LIFR also known as CD118 (Cluster of Differentiation 118), is a subunit of a receptor for leukemia inhibitory factor. This gene encodes a protein that belongs to the type I cytokine receptor family. This protein combines with a high-affinity converter subunit, gp130, to form a receptor complex that mediates the action of the leukemia inhibitory factor, a polyfunctional cytokine that is involved in cellular differentiation, proliferation and survival in the adult and the embryo. Mutations in this gene cause Schwartz-Jampel syndrome type 2, a disease belonging to the group of the bent-bone dysplasias. A translocation that involves the promoter of this gene, t(5,8)(p13,q12) with the pleiomorphic adenoma gene 1, is associated with salivary gland pleiomorphic adenoma, a common type of benign epithelial tumor of the salivary gland. Multiple splice variants encoding the same protein have been found for this gene.

Synonyms: CD118 antibody|CD118 antigen antibody|FLJ98106 antibody|FLJ99923 antibody|Leukemia inhibitory factor receptor alpha antibody|Leukemia inhibitory factor receptor antibody|LIF R antibody|LIF receptor antibody|LIF-R antibody|Lifr antibody|LIFR_HUMAN antibody|SJS2 antibody|STWS antibody|SWS antibody

Gene ID: 3977

UniProt: P42702

Pathways: JAK-STAT Signaling, Growth Factor Binding