PCSK6 antibody (C-Term)
-
- Target See all PCSK6 Antibodies
- PCSK6 (Proprotein Convertase Subtilisin/kexin Type 6 (PCSK6))
-
Binding Specificity
- AA 614-651, C-Term
-
Reactivity
- Human, Rat
-
Host
- Rabbit
-
Clonality
- Polyclonal
-
Conjugate
- This PCSK6 antibody is un-conjugated
-
Application
- Western Blotting (WB)
- Purpose
- Rabbit IgG polyclonal antibody for Proprotein convertase subtilisin/kexin type 6(PCSK6) detection. Tested with WB in Human,Rat.
- Sequence
- RNPEKQGKLK EWSLILYGTA EHPYHTFSAH QSRSRMLE
- Cross-Reactivity (Details)
- No cross reactivity with other proteins.
- Characteristics
-
Rabbit IgG polyclonal antibody for Proprotein convertase subtilisin/kexin type 6(PCSK6) detection. Tested with WB in Human,Rat.
Gene Name: proprotein convertase subtilisin/kexin type 6
Protein Name: Proprotein convertase subtilisin/kexin type 6 - Purification
- Immunogen affinity purified.
- Immunogen
- A synthetic peptide corresponding to a sequence at the C-terminus of human PACE4 (614-651aa RNPEKQGKLKEWSLILYGTAEHPYHTFSAHQSRSRMLE), different from the related rat sequence by two amino acids.
- Isotype
- IgG
- Top Product
- Discover our top product PCSK6 Primary Antibody
-
-
- Application Notes
-
WB: Concentration: 0.1-0.5 μg/mL, Tested Species: Human, Rat
Notes: Tested Species: Species with positive results.
Other applications have not been tested. Optimal dilutions should be determined by end users. - Comment
-
Antibody can be supported by chemiluminescence kit ABIN921124 in WB.
- Restrictions
- For Research Use only
-
- Format
- Lyophilized
- Reconstitution
- Add 0.2 mL of distilled water will yield a concentration of 500 μg/mL.
- Concentration
- 500 μg/mL
- Buffer
- Each vial contains 5 mg BSA, 0.9 mg NaCl, 0.2 mg Na2HPO4, 0.05 mg Sodium azide.
- Preservative
- Sodium azide
- Precaution of Use
- This product contains Sodium azide: a POISONOUS AND HAZARDOUS SUBSTANCE which should be handled by trained staff only.
- Handling Advice
- Avoid repeated freezing and thawing.
- Storage
- 4 °C/-20 °C
- Storage Comment
-
At -20°C for one year. After reconstitution, at 4°C for one month.
It can also be aliquotted and stored frozen at -20 °C for a longer time. Avoid repeated freezing and thawing.
-
- Target
- PCSK6 (Proprotein Convertase Subtilisin/kexin Type 6 (PCSK6))
- Alternative Name
- PCSK6 (PCSK6 Products)
- Synonyms
- PACE4 antibody, PCSK6 antibody, SPC4 antibody, C86343 antibody, Pace4 antibody, Spc4 antibody, PACE4AIIa antibody, Xpace4 antibody, spc4 antibody, proprotein convertase subtilisin/kexin type 6 antibody, peptidase S8 antibody, proprotein convertase subtilisin/kexin type 6 L homeolog antibody, PCSK6 antibody, EAMY_RS27925 antibody, pcsk6 antibody, Pcsk6 antibody, pcsk6.L antibody
- Background
-
Proprotein convertase subtilisin/kexin type 6 is an enzyme that in humans is encoded by the PCSK6 gene. This gene encodes a member of the subtilisin-like proprotein convertase family, which includes proteases that process protein and peptide precursors trafficking through regulated or constitutive branches of the secretory pathway. The encoded protein undergoes an initial autocatalytic processing event in the ER to generate a heterodimer which exits the ER and sorts to the trans-Golgi network where a second autocatalytic event takes place and the catalytic activity is acquired. The encoded protease is constitutively secreted into the extracellular matrix and expressed in many tissues, including neuroendocrine, liver, gut, and brain. This gene encodes one of the seven basic amino acid-specific members which cleave their substrates at single or paired basic residues. Some of its substrates include transforming growth factor beta related proteins, proalbumin, and von Willebrand factor. This gene is thought to play a role in tumor progression and left-right patterning. Alternatively spliced transcript variants encoding different isoforms have been identified.
Synonyms: Paired basic amino acid cleaving enzyme 4 antibody|Paired basic amino acid cleaving system 4 antibody|PCSK6 antibody|PCSK6_HUMAN antibody|Proprotein convertase subtilisin/kexin type 6 antibody|SPC4 antibody|Subtilisin like protease antibody|Subtilisin-like proprotein convertase 4 antibody|subtilisin/kexin like protease PACE4 antibody|Subtilisin/kexin-like protease PACE4 antibody - Gene ID
- 5046
- UniProt
- P29122
- Pathways
- Neurotrophin Signaling Pathway, SARS-CoV-2 Protein Interactome
-