CD36 antibody (N-Term)
-
- Target See all CD36 Antibodies
- CD36
-
Binding Specificity
- AA 31-66, N-Term
-
Reactivity
- Human, Mouse, Rat
-
Host
- Rabbit
-
Clonality
- Polyclonal
-
Conjugate
- This CD36 antibody is un-conjugated
-
Application
- Western Blotting (WB), Immunohistochemistry (Paraffin-embedded Sections) (IHC (p))
- Purpose
- Rabbit IgG polyclonal antibody for Platelet glycoprotein 4(CD36) detection. Tested with WB, IHC-P in Human,Mouse,Rat.
- Sequence
- DLLIQKTIKK QVVLEEGTIA FKNWVKTGTE VYRQFW
- Cross-Reactivity (Details)
- No cross reactivity with other proteins.
- Characteristics
-
Rabbit IgG polyclonal antibody for Platelet glycoprotein 4(CD36) detection. Tested with WB, IHC-P in Human,Mouse,Rat.
Gene Name: CD36 Molecule (thrombospondin receptor)
Protein Name: Platelet glycoprotein 4 - Purification
- Immunogen affinity purified.
- Immunogen
- A synthetic peptide corresponding to a sequence at the N-terminus of human CD36 (31-66aa DLLIQKTIKKQVVLEEGTIAFKNWVKTGTEVYRQFW), different from the related mouse sequence by six amino acids, and from the related rat sequence by four amino acids.
- Isotype
- IgG
- Top Product
- Discover our top product CD36 Primary Antibody
-
-
- Application Notes
-
WB: Concentration: 0.1-0.5 μg/mL, Tested Species: Human, Mouse, Rat
IHC-P: Concentration: 0.5-1 μg/mL, Tested Species: Human, Rat, Epitope Retrieval by Heat: Boiling the paraffin sections in 10 mM citrate buffer, pH 6.0, for 20 mins is required for the staining of formalin/paraffin sections.
Notes: Tested Species: Species with positive results. Other applications have not been tested. Optimal dilutions should be determined by end users. - Comment
-
Antibody can be supported by chemiluminescence kit ABIN921124 in WB, supported by ABIN921231 in IHC(P).
- Restrictions
- For Research Use only
-
- Format
- Lyophilized
- Reconstitution
- Add 0.2 mL of distilled water will yield a concentration of 500 μg/mL.
- Concentration
- 500 μg/mL
- Buffer
- Each vial contains 5 mg BSA, 0.9 mg NaCl, 0.2 mg Na2HPO4, 0.05 mg Sodium azide.
- Preservative
- Sodium azide
- Precaution of Use
- This product contains Sodium azide: a POISONOUS AND HAZARDOUS SUBSTANCE which should be handled by trained staff only.
- Handling Advice
- Avoid repeated freezing and thawing.
- Storage
- 4 °C/-20 °C
- Storage Comment
-
At -20°C for one year. After reconstitution, at 4°C for one month.
It can also be aliquotted and stored frozen at -20 °C for a longer time. Avoid repeated freezing and thawing.
-
- Target
- CD36
- Alternative Name
- CD36 (CD36 Products)
- Synonyms
- BDPLT10 antibody, CHDS7 antibody, FAT antibody, GP3B antibody, GP4 antibody, GPIV antibody, PASIV antibody, SCARB3 antibody, Fat antibody, Scarb3 antibody, GPIIIB antibody, PAS-4 antibody, zgc:92513 antibody, CD36 molecule antibody, CD36 molecule (thrombospondin receptor) antibody, CD36 antibody, Cd36 antibody, cd36 antibody
- Background
-
CD36 (cluster of differentiation 36), also known as FAT (fatty acid translocase), FAT/CD36, (FAT)/CD36, SCARB3, GP88, glycoprotein IV (gpIV), and glycoprotein IIIb (gpIIIb), is anintegral membrane protein found on the surface of many cell types in vertebrate animals. CD36 is a member of the class B scavenger receptor family of cell surface proteins. It is mapped to 7q21.11. And CD36 binds many ligands including collagen, thrombospondin, erythrocytes parasitized with Plasmodium falciparum, oxidized low density lipoprotein, native lipoproteins, oxidized phospholipids, and long-chain fatty acids. In addition, CD36 function in long-chain fatty acid uptake and signaling can be irreversibly inhibited by sulfo-N-succinimidyl oleate (SSO), which binds lysine 164 within a hydrophobic pocked shared by several CD36 ligands, e.g. fatty acid and oxLDL.
Synonyms: Adipocyte membrane protein antibody|CD36 antibody|CD36 antibody|CD36 antigen (collagen type I receptor, thrombospondin receptor) antibody|CD36 antigen antibody|CD36 Molecule (thrombospondin receptor) antibody|CD36 Molecule antibody|CD36_HUMAN antibody|CHDS7 antibody|Cluster determinant 36 antibody|Collagen receptor, platelet antibody|FAT antibody| Fatty acid translocase antibody|Fatty acid transport protein antibody|Glycoprotein IIIb antibody|GP IIIb antibody|GP3B antibody|GP4 antibody|GPIIIB antibody|GPIV antibody| Leukocyte differentiation antigen CD36 antibody|MGC108510 antibody|MGC91634 antibody|PAS 4 protein antibody|PAS IV antibody|PAS-4 antibody|PASIV antibody|Platelet collagen receptor antibody|Platelet glycoprotein 4 antibody|Platelet glycoprotein IV antibody|scarb3 antibody|Scavenger receptor class B member 3 antibody|Thrombospondin receptor antibody - Gene ID
- 948
- UniProt
- P16671
- Pathways
- TLR Signaling, Peptide Hormone Metabolism, Response to Growth Hormone Stimulus, Activation of Innate immune Response, Cellular Response to Molecule of Bacterial Origin, Regulation of Lipid Metabolism by PPARalpha, Positive Regulation of Immune Effector Process, Production of Molecular Mediator of Immune Response, Hepatitis C, Toll-Like Receptors Cascades, Lipid Metabolism, S100 Proteins
-