Phone:
+1 877 302 8632
Fax:
+1 888 205 9894 (Toll-free)
E-Mail:
orders@antibodies-online.com

LCK antibody (C-Term)

LCK Reactivity: Human, Mouse, Rat WB, IHC (p) Host: Rabbit Polyclonal unconjugated
Catalog No. ABIN3043870
  • Target See all LCK Antibodies
    LCK (Lymphocyte-Specific Protein tyrosine Kinase (LCK))
    Binding Specificity
    • 28
    • 16
    • 15
    • 11
    • 10
    • 8
    • 8
    • 8
    • 6
    • 5
    • 5
    • 3
    • 3
    • 3
    • 2
    • 2
    • 2
    • 2
    • 2
    • 2
    • 2
    • 2
    • 2
    • 2
    • 1
    • 1
    • 1
    • 1
    • 1
    • 1
    • 1
    • 1
    • 1
    • 1
    • 1
    • 1
    • 1
    • 1
    • 1
    • 1
    • 1
    • 1
    • 1
    • 1
    • 1
    • 1
    • 1
    • 1
    AA 468-506, C-Term
    Reactivity
    • 167
    • 94
    • 59
    • 9
    • 6
    • 6
    • 4
    • 4
    • 4
    • 3
    • 3
    • 2
    • 1
    Human, Mouse, Rat
    Host
    • 151
    • 14
    • 2
    Rabbit
    Clonality
    • 146
    • 22
    Polyclonal
    Conjugate
    • 96
    • 10
    • 10
    • 7
    • 6
    • 5
    • 4
    • 4
    • 4
    • 4
    • 4
    • 4
    • 2
    • 2
    • 2
    • 2
    • 2
    This LCK antibody is un-conjugated
    Application
    • 129
    • 88
    • 30
    • 29
    • 24
    • 20
    • 15
    • 14
    • 13
    • 10
    • 3
    • 3
    • 2
    • 1
    • 1
    • 1
    Western Blotting (WB), Immunohistochemistry (Paraffin-embedded Sections) (IHC (p))
    Purpose
    Rabbit IgG polyclonal antibody for Tyrosine-protein kinase Lck(LCK) detection. Tested with WB, IHC-P in Human,Mouse,Rat.
    Sequence
    ELYQLMRLCW KERPEDRPTF DYLRSVLEDF FTATEGQYQ
    Cross-Reactivity (Details)
    No cross reactivity with other proteins.
    Characteristics
    Rabbit IgG polyclonal antibody for Tyrosine-protein kinase Lck(LCK) detection. Tested with WB, IHC-P in Human,Mouse,Rat.
    Gene Name: LCK proto-oncogene, Src family tyrosine kinase
    Protein Name: Tyrosine-protein kinase Lck
    Purification
    Immunogen affinity purified.
    Immunogen
    A synthetic peptide corresponding to a sequence at the C-terminus of human Lck (468-506aa ELYQLMRLCWKERPEDRPTFDYLRSVLEDFFTATEGQYQ), different from the related mouse and rat sequences by three amino acids.
    Isotype
    IgG
    Top Product
    Discover our top product LCK Primary Antibody
  • Application Notes
    WB: Concentration: 0.1-0.5 μg/mL, Tested Species: Human
    IHC-P: Concentration: 0.5-1 μg/mL, Tested Species: Human, Mouse, Rat, Epitope Retrieval by Heat: Boiling the paraffin sections in 10 mM citrate buffer, pH 6.0, for 20 mins is required for the staining of formalin/paraffin sections.
    Notes: Tested Species: Species with positive results. Other applications have not been tested. Optimal dilutions should be determined by end users.
    Comment

    Antibody can be supported by chemiluminescence kit ABIN921124 in WB, supported by ABIN921231 in IHC(P).

    Restrictions
    For Research Use only
  • Format
    Lyophilized
    Reconstitution
    Add 0.2 mL of distilled water will yield a concentration of 500 μg/mL.
    Concentration
    500 μg/mL
    Buffer
    Each vial contains 5 mg BSA, 0.9 mg NaCl, 0.2 mg Na2HPO4, 0.05 mg Sodium azide.
    Preservative
    Sodium azide
    Precaution of Use
    This product contains Sodium azide: a POISONOUS AND HAZARDOUS SUBSTANCE which should be handled by trained staff only.
    Handling Advice
    Avoid repeated freezing and thawing.
    Storage
    4 °C/-20 °C
    Storage Comment
    At -20°C for one year. After reconstitution, at 4°C for one month.
    It can also be aliquotted and stored frozen at -20 °C for a longer time. Avoid repeated freezing and thawing.
  • Target
    LCK (Lymphocyte-Specific Protein tyrosine Kinase (LCK))
    Alternative Name
    LCK (LCK Products)
    Synonyms
    zgc:136695 antibody, LCK antibody, Hck-3 antibody, Lsk antibody, Lskt antibody, p56 antibody, p56Lck antibody, LSK antibody, YT16 antibody, p56lck antibody, pp58lck antibody, P56LCK antibody, tkl antibody, Lck1 antibody, Lcktkr antibody, LCK proto-oncogene, Src family tyrosine kinase antibody, lymphocyte protein tyrosine kinase antibody, lck antibody, LCK antibody, Lck antibody
    Background
    Lck (or lymphocyte-specific protein tyrosine kinase) is a 56 kDa protein that is found inside specializedcells of the immune system called lymphocytes. The human LCK gene is mapped to chromosome 1p35-p32. This gene is a member of the Src family of protein tyrosine kinases (PTKs). The encoded protein is a key signaling molecule in the selection and maturation of developing T-cells. It contains N-terminal sites for myristylation and palmitylation, a PTK domain, and SH2 and SH3 domains which are involved in mediating protein-protein interactions with phosphotyrosine-containing and proline-rich motifs, respectively. The protein localizes to the plasma membrane and pericentrosomal vesicles, and binds to cell surface receptors, including CD4 and CD8, and other signaling molecules. Multiple alternatively spliced variants, encoding the same protein, have been described.

    Synonyms: IMD22 antibody|LCK antibody|Lck p56 antibody|LCK proto-oncogene, Src family tyrosine kinase antibody|LCK_HUMAN antibody|Leukocyte C-terminal Src kinase antibody|LSK antibody|Lymphocyte cell specific protein tyrosine kinase antibody|Lymphocyte cell-specific protein-tyrosine kinase antibody|Lymphocyte specific protein tyrosine kinase antibody|Membrane associated protein tyrosine kinase antibody| Oncogene lck antibody|P56 LCK antibody|p56(LSTRA) protein tyrosine kinase antibody|p56-LCK antibody|p56lck antibody|pp58 lck antibody| pp58lck antibody|Protein YT16 antibody|Proto oncogene tyrosine protein kinase LCK antibody|Proto-oncogene Lck antibody|Protooncogene tyrosine protein kinase LCK antibody|T cell specific protein tyrosine kinase antibody|T cell-specific protein-tyrosine kinase antibody|T lymphocyte specific protein tyrosine kinase p56lck antibody|Tyrosine-protein kinase Lck antibody|YT 16 antibody|YT16 antibody
    Gene ID
    3932
    UniProt
    P06239
    Pathways
    TCR Signaling, Fc-epsilon Receptor Signaling Pathway, EGFR Signaling Pathway, Neurotrophin Signaling Pathway, Transition Metal Ion Homeostasis, Positive Regulation of Endopeptidase Activity, CXCR4-mediated Signaling Events, Thromboxane A2 Receptor Signaling
You are here:
Support