PDGFRA antibody (C-Term)

Catalog No. ABIN3043897

Product Details anti-PDGFRA Antibody

Target: PDGFRA (Platelet Derived Growth Factor Receptor alpha (PDGFRA))

Binding Specificity: AA 968-1002, C-Term

Reactivity: Human, Mouse, Rat

Host: Rabbit

Clonality: Polyclonal

Conjugate: This PDGFRA antibody is un-conjugated

Application: Western Blotting (WB), Immunohistochemistry (Paraffin-embedded Sections) (IHC (p))

Purpose: Rabbit IgG polyclonal antibody for Platelet-derived growth factor receptor alpha(PDGFRA) detection. Tested with WB, IHC-P in Human,Mouse,Rat.

Sequence: DFLKSDHPAV ARMRVDSDNA YIGVTYKNEE DKLKD

Cross-Reactivity (Details): No cross reactivity with other proteins.

Characteristics: Rabbit IgG polyclonal antibody for Platelet-derived growth factor receptor alpha(PDGFRA) detection. Tested with WB, IHC-P in Human,Mouse,Rat.
Gene Name: platelet-derived growth factor receptor, alpha polypeptide
Protein Name: Platelet-derived growth factor receptor alpha

Purification: Immunogen affinity purified.

Immunogen: A synthetic peptide corresponding to a sequence at the C-terminus of human PDGFRA (968-1002aa DFLKSDHPAVARMRVDSDNAYIGVTYKNEEDKLKD), identical to the related mouse sequence, and different from the related rat sequence by one amino acid.

Isotype: IgG

Application Details

Application Notes: WB: Concentration: 0.1-0.5 μg/mL, Tested Species: Human, Mouse, Rat
IHC-P: Concentration: 0.5-1 μg/mL, Tested Species: Human, Epitope Retrieval by Heat: Boiling the paraffin sections in 10 mM citrate buffer, pH 6.0, for 20 mins is required for the staining of formalin/paraffin sections.
Notes: Tested Species: Species with positive results. Other applications have not been tested. Optimal dilutions should be determined by end users.

Comment:

Antibody can be supported by chemiluminescence kit ABIN921124 in WB, supported by ABIN921231 in IHC(P).

Restrictions: For Research Use only

Handling

Format: Lyophilized

Reconstitution: Add 0.2 mL of distilled water will yield a concentration of 500 μg/mL.

Concentration: 500 μg/mL

Buffer: Each vial contains 5 mg BSA, 0.9 mg NaCl, 0.2 mg Na2HPO4, 0.05 mg Sodium azide.

Preservative: Sodium azide

Precaution of Use: This product contains Sodium azide: a POISONOUS AND HAZARDOUS SUBSTANCE which should be handled by trained staff only.

Handling Advice: Avoid repeated freezing and thawing.

Storage: 4 °C/-20 °C

Storage Comment: At -20°C for one year. After reconstitution, at 4°C for one month.
It can also be aliquotted and stored frozen at -20 °C for a longer time. Avoid repeated freezing and thawing.

References for anti-PDGFRA antibody (ABIN3043897)

Zeng, Zhao, Ouyang, Zhao, Zhang, Chen, Yu, Lei: "Label-retaining assay enriches tumor-initiating cells in glioblastoma spheres cultivated in serum-free medium." in: Oncology letters, Vol. 12, Issue 2, pp. 815-824, (2016) (PubMed).

Target Details for PDGFRA

Target: PDGFRA (Platelet Derived Growth Factor Receptor alpha (PDGFRA))

Alternative Name: PDGFRA (PDGFRA Products)

Synonyms: AI115593 antibody, CD140a antibody, Pdgfr-2 antibody, APDGFR antibody, PDGFACE antibody, CD140A antibody, PDGFR-2 antibody, PDGFR2 antibody, RHEPDGFRA antibody, PDGFR antibody, PDGFR-A antibody, platelet derived growth factor receptor alpha antibody, platelet derived growth factor receptor, alpha polypeptide antibody, platelet-derived growth factor receptor, alpha polypeptide L homeolog antibody, platelet-derived growth factor receptor, alpha polypeptide antibody, PDGFRA antibody, Pdgfra antibody, pdgfra.L antibody

Background: PDGFRA (Platelet-derived growth factor receptor, alpha), also called PDGFR2, encodes a cell surface tyrosine kinase receptor for members of the platelet-derived growth factor family. The PDGFA gene is mapped on 4q12. The PDGFRA-FIP1L1 gene is a constitutively activated tyrosine kinase that transforms hematopoietic cells and is a therapeutic target of imatinib. And the PDGFRA gene contains 23 exons spanning about 65 kb. Using the human PDGFRA promoter linked to a luciferase reporter, Joosten et al. showed that PAX1 acts as a transcriptional activator of the PDGFRA gene in differentiated human embryonal carcinoma cells. PDGFRA is responsible for mediating cellular contraction of multiple growth factors: TGFB1 and members of the PDGF family. Lei et al. noted that in the rabbit model of the disease, PDGFRA is dramatically more capable of promoting PVR than is the closely related PDGFRB. PDGFRA is a critical receptor required for human CMV infection, and thus a target for novel antiviral therapies.

Synonyms: Alpha platelet derived growth factor receptor antibody|Alpha-type platelet-derived growth factor receptor antibody|CD 140a antibody| CD140 antigen-like family member A antibody| CD140a antibody|CD140a antigen antibody|MGC74795 antibody|PDGF alpha chain antibody|PDGF R alpha antibody|PDGF-R-alpha antibody|PDGFR 2 antibody|PDGFR A antibody|PDGFR alpha antibody|PDGFR2 antibody|PDGFRA antibody| PDGFRA/BCR fusion antibody|PGFRA_HUMAN antibody|Platelet derived growth factor receptor 2 antibody|Platelet derived growth factor receptor alpha antibody|Platelet derived growth factor receptor alpha polypeptide antibody|Platelet derived growth factor receptor antibody|Rearranged in hypereosinophilia platelet derived growth factor receptor alpha fusion protein antibody|RHEPDGFRA antibody

Gene ID: 5156

UniProt: P16234

Pathways: RTK Signaling, Fc-epsilon Receptor Signaling Pathway, EGFR Signaling Pathway, Neurotrophin Signaling Pathway, Platelet-derived growth Factor Receptor Signaling