XRCC6 antibody (C-Term)

Catalog No. ABIN3043965

Product Details anti-XRCC6 Antibody

Target: XRCC6 (X-Ray Repair Complementing Defective Repair in Chinese Hamster Cells 6 (XRCC6))

Binding Specificity: AA 464-496, C-Term

Reactivity: Human

Host: Rabbit

Clonality: Polyclonal

Conjugate: This XRCC6 antibody is un-conjugated

Application: Western Blotting (WB), Immunohistochemistry (Paraffin-embedded Sections) (IHC (p))

Purpose: Rabbit IgG polyclonal antibody for X-ray repair cross-complementing protein 6(XRCC6) detection. Tested with WB, IHC-P in Human.

Sequence: AIVEKLRFTY RSDSFENPVL QQHFRNLEAL ALD

Cross-Reactivity (Details): No cross reactivity with other proteins.

Characteristics: Rabbit IgG polyclonal antibody for X-ray repair cross-complementing protein 6(XRCC6) detection. Tested with WB, IHC-P in Human.
Gene Name: X-ray repair complementing defective repair in Chinese hamster cells 6
Protein Name: X-ray repair cross-complementing protein 6

Purification: Immunogen affinity purified.

Immunogen: A synthetic peptide corresponding to a sequence at C-terminus of human Ku70 (464-496aa AIVEKLRFTYRSDSFENPVLQQHFRNLEALALD), different from the related mouse sequence by one amino acid.

Isotype: IgG

Application Details

Application Notes: WB: Concentration: 0.1-0.5 μg/mL, Tested Species: Human
IHC-P: Concentration: 0.5-1 μg/mL, Tested Species: Human, Epitope Retrieval by Heat: Boiling the paraffin sections in 10 mM citrate buffer, pH 6.0, for 20 mins is required for the staining of formalin/paraffin sections.
Notes: Tested Species: Species with positive results. Other applications have not been tested. Optimal dilutions should be determined by end users.

Comment:

Antibody can be supported by chemiluminescence kit ABIN921124 in WB, supported by ABIN921231 in IHC(P).

Restrictions: For Research Use only

Handling

Format: Lyophilized

Reconstitution: Add 0.2 mL of distilled water will yield a concentration of 500 μg/mL.

Concentration: 500 μg/mL

Buffer: Each vial contains 5 mg BSA, 0.9 mg NaCl, 0.2 mg Na2HPO4, 0.05 mg Sodium azide.

Preservative: Sodium azide

Precaution of Use: This product contains Sodium azide: a POISONOUS AND HAZARDOUS SUBSTANCE which should be handled by trained staff only.

Handling Advice: Avoid repeated freezing and thawing.

Storage: 4 °C/-20 °C

Storage Comment: At -20°C for one year. After reconstitution, at 4°C for one month.
It can also be aliquotted and stored frozen at -20 °C for a longer time. Avoid repeated freezing and thawing.

Target Details for XRCC6

Target: XRCC6 (X-Ray Repair Complementing Defective Repair in Chinese Hamster Cells 6 (XRCC6))

Alternative Name: XRCC6 (XRCC6 Products)

Synonyms: CTC75 antibody, CTCBF antibody, G22P1 antibody, KU70 antibody, ML8 antibody, TLAA antibody, 70kDa antibody, G22p1 antibody, Ku70 antibody, Kup70 antibody, X-ray repair cross complementing 6 antibody, ATP-dependent DNA helicase II, 70 kDa subunit antibody, X-ray repair complementing defective repair in Chinese hamster cells 6 L homeolog antibody, X-ray repair complementing defective repair in Chinese hamster cells 6 antibody, XRCC6 antibody, Bm1_41430 antibody, xrcc6.L antibody, Xrcc6 antibody

Background: XRCC6 (X-Ray Repair, Complementing Defective, In Chinese Hamster, 6), also called Ku70, G22P1 or TLAA, is a protein that in humans, is encoded by the XRCC6 gene. In addition, the XRCC6 gene encodes subunit p70 of the p70/p80 autoantigen which consists of 2 proteins of molecular mass of approximately 70,000 and 80,000 daltons that dimerize to form a 10 S DNA-binding complex. The XRCC6 gene is mapped to 22q13.2. XRCC6 and Mre11 are differentially expressed during meiosis. XRCC6 interacts with Baxa, a mediator of mitochondrial-dependent apoptosis. Disruption of both FANCC and XRCC6 suppressed sensitivity to crosslinking agents, diminished chromosome breaks, and reversed defective homologous recombination. Ku70 binds directly to free DNA ends, committing them to NHEJ repair. In early meiotic prophase, however, when meiotic recombination is most probably initiated, Mre11 was abundant, whereas XRCC6 was not detectable.

Synonyms: 5''-deoxyribose-5-phosphate lyase Ku70 antibody|5''-dRP lyase Ku70 antibody|70 kDa subunit of Ku antigen antibody|ATP dependent DNA helicase 2 subunit 1 antibody|ATP dependent DNA helicase II 70 kDa subunit antibody|ATP-dependent DNA helicase 2 subunit 1 antibody|ATP-dependent DNA helicase II 70 kDa subunit antibody|CTC box binding factor 75 kDa subunit antibody|CTC box-binding factor 75 kDa subunit antibody|CTC75 antibody|CTCBF antibody|DNA repair protein XRCC6 antibody|G22P1 antibody|Ku 70 antibody|Ku autoantigen 70 kDa antibody| Ku autoantigen p70 subunit antibody|Ku autoantigen, 70 kDa antibody|Ku p70 antibody|Ku70 antibody|Ku70 DNA binding component of DNA-dependent proteinkinase complex (thyroid autoantigen 70 kDa antibody|Kup70 antibody|Lupus Ku autoantigen protein p70 antibody|ML8 antibody|Thyroid autoantigen 70kD (Ku antigen) antibody|Thyroid autoantigen antibody| Thyroid lupus autoantigen antibody|Thyroid lupus autoantigen p70 antibody|Thyroid-lupus autoantigen antibody|TLAA antibody|X ray repair complementing defective repair in Chinese hamster cells 6 antibody|X-ray repair complementing defective repair in Chinese hamster cells 6 antibody|X-ray repair cross-complementing protein 6 antibody|XRCC 6 antibody|XRCC6 antibody|XRCC6_HUMAN antibody

Gene ID: 2547

UniProt: P12956

Pathways: DNA Damage Repair