APC2 antibody (N-Term)
-
- Target See all APC2 Antibodies
- APC2 (APC Regulator of WNT Signaling Pathway 2 (APC2))
-
Binding Specificity
- AA 51-90, N-Term
-
Reactivity
- Human
-
Host
- Rabbit
-
Clonality
- Polyclonal
-
Conjugate
- This APC2 antibody is un-conjugated
-
Application
- Western Blotting (WB)
- Purpose
- Rabbit IgG polyclonal antibody for Adenomatous polyposis coli protein 2(APC2) detection. Tested with WB in Human.
- Sequence
- KHLQGKLEQE ARVLVSSGQT EVLEQLKALQ MDITSLYNLK
- Cross-Reactivity (Details)
- No cross reactivity with other proteins.
- Characteristics
-
Rabbit IgG polyclonal antibody for Adenomatous polyposis coli protein 2(APC2) detection. Tested with WB in Human.
Gene Name: APC2, WNT signaling pathway regulator
Protein Name: Adenomatous polyposis coli protein 2 - Purification
- Immunogen affinity purified.
- Immunogen
- A synthetic peptide corresponding to a sequence at the N-terminus of human APC2 (51-90aa KHLQGKLEQEARVLVSSGQTEVLEQLKALQMDITSLYNLK), different from the related mouse sequence by two amino acids.
- Isotype
- IgG
- Top Product
- Discover our top product APC2 Primary Antibody
-
-
- Application Notes
-
WB: Concentration: 0.1-0.5 μg/mL, Tested Species: Human
Notes: Tested Species: Species with positive results.
Other applications have not been tested. Optimal dilutions should be determined by end users. - Comment
-
Antibody can be supported by chemiluminescence kit ABIN921124 in WB.
- Restrictions
- For Research Use only
-
- Format
- Lyophilized
- Reconstitution
- Add 0.2 mL of distilled water will yield a concentration of 500 μg/mL.
- Concentration
- 500 μg/mL
- Buffer
- Each vial contains 5 mg BSA, 0.9 mg NaCl, 0.2 mg Na2HPO4, 0.05 mg Sodium azide.
- Preservative
- Sodium azide
- Precaution of Use
- This product contains Sodium azide: a POISONOUS AND HAZARDOUS SUBSTANCE which should be handled by trained staff only.
- Handling Advice
- Avoid repeated freezing and thawing.
- Storage
- 4 °C/-20 °C
- Storage Comment
-
At -20°C for one year. After reconstitution, at 4°C for one month.
It can also be aliquotted and stored frozen at -20 °C for a longer time. Avoid repeated freezing and thawing.
-
- Target
- APC2 (APC Regulator of WNT Signaling Pathway 2 (APC2))
- Alternative Name
- APC2 (APC2 Products)
- Synonyms
- APCL antibody, AI852447 antibody, R75424 antibody, APC2, WNT signaling pathway regulator antibody, adenomatosis polyposis coli 2 antibody, APC2 antibody, Apc2 antibody
- Background
-
APC2, which is also called APCL, is a deduced 2,303-amino acid protein that contains an N-terminal coiled-coil domain, followed by an armadillo domain and five 20-amino acid repeats. The human APC2 gene is mapped to chromosome 19p13.3. It is found that the 20-amino acid repeat domain of APCL could bind beta-catenin (CTNNB1) and deplete the intracellular beta-catenin pool. A reporter gene assay revealed that APCL could regulate interaction of beta-catenin with T cell-specific transcription factors (TCF7), although less efficiently than APC.
Synonyms: APCL | APC2 | APC 2 | O95996 - Gene ID
- 10297
- Pathways
- WNT Signaling
-