PML antibody (N-Term)

Catalog No. ABIN4886700

Product Details anti-PML Antibody

Target: PML (Promyelocytic Leukemia (PML))

Binding Specificity: AA 140-177, N-Term

Reactivity: Mouse

Host: Rabbit

Clonality: Polyclonal

Conjugate: This PML antibody is un-conjugated

Application: Western Blotting (WB), Immunohistochemistry (Paraffin-embedded Sections) (IHC (p))

Purpose: Rabbit IgG polyclonal antibody for Protein PML(PML) detection. Tested with WB, IHC-P in Mouse.

Sequence: LADFWCFECE QLICSKCFEA HQWYLKHEAR PLADLRDN

Cross-Reactivity (Details): No cross reactivity with other proteins.

Characteristics: Rabbit IgG polyclonal antibody for Protein PML(PML) detection. Tested with WB, IHC-P in Mouse.
Gene Name: promyelocytic leukemia
Protein Name: Protein PML

Purification: Immunogen affinity purified.

Immunogen: A synthetic peptide corresponding to a sequence at the N-terminus of mouse PML Protein (140-177aa LADFWCFECEQLICSKCFEAHQWYLKHEARPLADLRDN), different from the related human sequence by six amino acids.

Isotype: IgG

Application Details

Application Notes: WB: Concentration: 0.1-0.5 μg/mL, Tested Species: Mouse
IHC-P: Concentration: 0.5-1 μg/mL, Tested Species: Mouse, Epitope Retrieval by Heat: Boiling the paraffin sections in 10 mM citrate buffer, pH 6.0, for 20 mins is required for the staining of formalin/paraffin sections.
Notes: Tested Species: Species with positive results. Other applications have not been tested. Optimal dilutions should be determined by end users.

Comment:

Antibody can be supported by chemiluminescence kit ABIN921124 in WB, supported by ABIN921231 in IHC(P).

Restrictions: For Research Use only

Handling

Format: Lyophilized

Reconstitution: Add 0.2 mL of distilled water will yield a concentration of 500 μg/mL.

Concentration: 500 μg/mL

Buffer: Each vial contains 5 mg BSA, 0.9 mg NaCl, 0.2 mg Na2HPO4, 0.05 mg Sodium azide.

Preservative: Sodium azide

Precaution of Use: This product contains Sodium azide: a POISONOUS AND HAZARDOUS SUBSTANCE which should be handled by trained staff only.

Handling Advice: Avoid repeated freezing and thawing.

Storage: 4 °C/-20 °C

Storage Comment: At -20°C for one year. After reconstitution, at 4°C for one month.
It can also be aliquotted and stored frozen at -20 °C for a longer time. Avoid repeated freezing and thawing.

Target Details for PML

Target: PML (Promyelocytic Leukemia (PML))

Alternative Name: PML (PML Products)

Synonyms: MYL antibody, PP8675 antibody, RNF71 antibody, TRIM19 antibody, 1200009E24Rik antibody, AI661194 antibody, Trim19 antibody, RGD1562602 antibody, PML antibody, promyelocytic leukemia antibody, PML antibody, Pml antibody

Background: The protein encoded by this gene is a member of the tripartite motif (TRIM) family. The TRIM motif includes three zinc-binding domains, a RING, a B-box type 1 and a B-box type 2, and a coiled-coil region. This phosphoprotein localizes to nuclear bodies where it functions as a transcription factor and tumor suppressor. Its expression is cell-cycle related and it regulates the p53 response to oncogenic signals. The gene is often involved in the translocation with the retinoic acid receptor alpha gene associated with acute promyelocytic leukemia (APL). Extensive alternative splicing of this gene results in several variations of the protein's central and C-terminal regions, all variants encode the same N-terminus. Alternatively spliced transcript variants encoding different isoforms have been identified.

Synonyms: MYL | Pml | PP8675 | Protein PML | RNF 71 | TRIM 19 | P29590

Gene ID: 18854

UniProt: Q60953

Pathways: p53 Signaling, Retinoic Acid Receptor Signaling Pathway, Maintenance of Protein Location, Positive Regulation of Endopeptidase Activity, Protein targeting to Nucleus